KEGG   Bos taurus (cow): 282177Help
Entry
282177            CDS       T01008                                 

Gene name
CHRNA5
Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-5 precursor
  KO
K04807  nicotinic acetylcholine receptor alpha-5
Organism
bta  Bos taurus (cow)
Pathway
bta04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    282177 (CHRNA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    282177 (CHRNA5)
Ion channels [BR:bta04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   282177 (CHRNA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 282177
NCBI-ProteinID: NP_776939
BGD-bta: BT11569
Ensembl: ENSBTAG00000013657
VGNC: 27327
UniProt: Q8SPU7
Position
21
AA seq 475 aa AA seqDB search
MAAPGWGRWVLGLGPLLLQVFLPFQLVAGRWGPEGAGGGVRRGLAEPSVVAKHEDSLFKD
LFQDYERWVRPVEHLNDRIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPD
DYGGIKLIRVPSDSLWTPDIVLFDNADGRFEGASTKTVVRYDGTVTWTPPANYKSSCTID
VTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDS
CCWYPYITYSFVIKRLPLFYTLFLIIPCIGLSFLTVLVFYLPSNEGEKICLCTSVLVSLT
VFLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHDAMAPWVR
KIFLHKLPKLLCMRSHVDRYFSQKEEARSSRGPRSSRNALEAALDSVRYITRHVMKETDV
REVVEDWKFIAQVLDRMFLWTFLLVSVVGSLGLFVPVIYKWANIIVPIHIGNENK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgccggggtgggggcgctgggtcctcggcctcgggcccctcctgctccaggtc
ttcctccctttccagctggtcgcagggcgctggggtccggagggcgcggggggcggcgtg
cgccgaggattagctgaaccatccgttgttgccaaacacgaagatagtttgtttaaggat
ttatttcaagactacgaaagatgggttcgtcctgtggaacacctgaatgacagaataaaa
ataaagttcggcctcgcaatatctcagttagtggatgtggatgagaaaaatcagttaatg
acaaccaatgtctggttgaaacaggagtggatagatgtgaagttgagatggaaccctgat
gactacggtggaataaaacttatacgtgtcccttcagactctctctggactccagatatc
gttttgtttgataatgcagatggacgttttgaaggggccagtaccaaaaccgtcgtcagg
tacgacggcacggtgacctggactccaccggcaaactacaaaagttcatgtaccatcgac
gtcacatttttcccatttgatctccaaaactgttccatgaaatttggttcttggacttac
gacggatcacaggttgatataattttggaggaccaagatgtagacaagagagattttttt
gataatggagaatgggaaattgtcagcgcaacagggagcaaaggaaacagaaccgacagc
tgttgctggtatccttacatcacttactcgtttgtaattaagcgtctgcctctcttttat
accttgttcctcattataccctgtattgggctctcatttttaactgtacttgtcttctat
cttccttcaaatgaaggtgaaaagatctgtctctgcacttcagtacttgtgtctctgact
gtcttccttctcgttattgaagagatcataccctcatcttccaaagtcatacctctgatt
ggagagtacctggtgttcacgatgatttttgtgacactgtctatcatggtcactgtcttt
gctatcaacattcatcaccgttcttcctcaacgcacgacgctatggctccgtgggtccgc
aagatatttcttcacaagctaccgaaactgctttgcatgcgaagtcatgtagacaggtac
ttcagtcagaaggaggaagctcggagcagccgtggacccagatcttctagaaacgccctg
gaagctgcactggattccgttcgctatatcacaagacacgtcatgaaggagaccgatgtc
cgtgaggttgttgaagattggaaattcatagcccaggttcttgatcggatgtttctgtgg
acttttcttctggtttcagttgttggatctcttgggctttttgttcctgttatctataaa
tgggcaaatataatagtaccaattcatattggaaatgaaaataagtga

DBGET integrated database retrieval system