KEGG   Bos taurus (cow): 282178
Entry
282178            CDS       T01008                                 

Gene name
CHRNA7
Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-7 precursor
  KO
K04809  nicotinic acetylcholine receptor alpha-7
Organism
bta  Bos taurus (cow)
Pathway
bta04020  Calcium signaling pathway
bta04080  Neuroactive ligand-receptor interaction
bta04725  Cholinergic synapse
bta05010  Alzheimer disease
bta05022  Pathways of neurodegeneration - multiple diseases
bta05033  Nicotine addiction
bta05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    282178 (CHRNA7)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    282178 (CHRNA7)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    282178 (CHRNA7)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    282178 (CHRNA7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    282178 (CHRNA7)
   05022 Pathways of neurodegeneration - multiple diseases
    282178 (CHRNA7)
  09165 Substance dependence
   05033 Nicotine addiction
    282178 (CHRNA7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    282178 (CHRNA7)
Ion channels [BR:bta04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   282178 (CHRNA7)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb SUR7
Other DBs
NCBI-GeneID: 282178
NCBI-ProteinID: NP_776940
BGD-bta: BT12368
UniProt: P54131
Position
21
AA seq 499 aa
MRGSLCLALAASILHVSLQGEFQRKLYKDLVKNYNPLERPVANDSLPLTVYFSLSLLQIM
DVDEKNQVLTTNIWLQMTWTDHYLQWNASEYPGVKTVRFPDGQIWKPDILLYNSADERFD
ATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLDLQMQ
EADISGYIPNGEWDLVGVLGKRSEKFYECCKEPYPDVTFTVSIRRRTLYYGLNLLIPCVL
ISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMII
VGLSVVVTVIVLQYHHHDPDGGKMPKWTRVVLLNWCAWFLRMKRPGEDKVRPACQHNERR
CSLASVEMSAVAGPPATNGNLLYIGFRGLDTMHCAPTPDSGVVCGRVACSPTHDEHLLHA
GQPSEGDPDLAKILEEVRYIAHRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTILCT
IGILMSAPNFVEAVSKDFA
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgcgcggctcgttgtgcctggcgctggcagcgtcgatcttgcacgtgtccctgcaaggc
gagttccagaggaagctctacaaagacctggtgaagaactacaaccccttggagaggccg
gtggccaacgactcgctgccgctcacagtctacttctccctgagcctcctgcagatcatg
gacgtggatgagaagaaccaggtgttgaccaccaacatttggctacaaatgacttggaca
gatcactatttacagtggaatgcatccgagtatccaggcgtgaagacggttcgtttccca
gacggccagatctggaagccagacattctcctctacaacagtgctgatgaacggtttgat
gctacgttccacaccaatgtgttagtgaattcttctgggcactgccagtacctccctcca
ggcatctttaagagctcctgctacatcgatgtgcgctggttcccatttgatgtgcagcag
tgcaaactgaagtttgggtcctggtcttatggaggatggtccttggatctgcaaatgcag
gaggcagacatcagcggctatatcccaaatggagaatgggaccttgtgggggtcttgggc
aagcggagtgagaagttctacgagtgctgcaaagaaccctacccagacgtgaccttcacg
gtcagcatccgccgcaggactctctactacggcctcaacctgctcatcccctgtgtgctc
atctctgccctagccctcctcgtcttcttgctccctgcagactctggagagaaaatctcc
ctgggaatcacagttttactctccctcaccgtcttcatgctgctggtagctgagatcatg
cctgcgacctctgactcagtgcccttaatagcccagtacttcgccagcaccatgatcatc
gtgggcctctctgtggttgtcacggtgatcgtgctacagtaccaccaccacgaccctgat
ggtggcaagatgcccaagtggaccagagtcgtcctcctgaactggtgtgcctggttcctt
cgcatgaagaggccgggggaggacaaggtgcggccagcctgccagcacaacgagcggcgc
tgcagcctggccagcgtggagatgagcgcagtggcggggccgccggccaccaatggcaac
ctgctgtacatcggctttcgcggcctggacaccatgcactgcgcacccacccctgactca
ggggtcgtgtgcggccgcgtggcctgctccccaacccatgacgagcacctgctgcacgcc
ggccagccctctgagggggacccggacctagccaagatcctggaggaggtgcgctacatt
gcccaccgcttccgctgccaggatgagagtgaggccgtgtgcagtgagtggaagttcgcg
gcctgtgtggtggaccgcctgtgtctcatggccttctccgtcttcaccatcctctgcacc
attggcatcctgatgtcggcgcccaacttcgttgaagctgtgtccaaagacttcgcttga

DBGET integrated database retrieval system