KEGG   Bos taurus (cow): 282179Help
Entry
282179            CDS       T01008                                 

Gene name
CHRNB1
Definition
(RefSeq) acetylcholine receptor subunit beta precursor
  KO
K04812  nicotinic acetylcholine receptor beta-1
Organism
bta  Bos taurus (cow)
Pathway
bta04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    282179 (CHRNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    282179 (CHRNB1)
Ion channels [BR:bta04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   282179 (CHRNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Motif
Other DBs
NCBI-GeneID: 282179
NCBI-ProteinID: NP_776941
BGD-bta: BT11122
Ensembl: ENSBTAG00000019242
VGNC: 27330
UniProt: P04758
Position
19
AA seq 505 aa AA seqDB search
MTPGALLLLLLGVLGAHLAPGARGSEAEGRLREKLFSGYDSTVRPAREVGDRVWVSIGLT
LAQLISLNEKDEEMSTKVYLDLEWTDYRLSWDPEEHEGIDSLRISAESVWLPDVVLLNNN
DGNFDVALDINVVVSSDGSMRWQPPGIYRSSCSIQVTYFPFDWQNCTMVFSSYSYDSSEV
SLQTGLSPEGQERQEVYIHEGTFIENGQWEIIHKPSRLIQPSVDPRGGGEGRREEVTFYL
IIRRKPLFYLVNVIAPCILITLLAIFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVP
ETSLSVPIIIKYLMFTMVLVTFSVILSVVVLNLHHRSPHTHQMPLWVRQIFIHKLPLYLG
LKRPKPERDQMQEPPSIAPRDSPGSGWGRGTDEYFIRKPPNDFLFPKPNRFQPELSAPDL
RRFIDGPNRAVGLPPELREVVSSISYIARQLQEQEDHDVLKEDWQFVAMVVDRLFLWTFI
IFTSVGTLVIFLDATYHLPPADPFP
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaggggcgctgcttctgctcctgctgggggtgctgggggcacatctcgccccg
ggcgcccgcggctcggaggcggagggccgactccgcgagaaacttttctcaggctatgat
agcacggtgcggccggcgcgggaggtgggagaccgtgtctgggtcagcattggtctcacc
ctggcgcaactcatcagcctgaacgagaaggatgaggagatgagcacaaaagtctactta
gacctggaatggactgactacaggctcagctgggaccctgaggagcacgagggcatcgat
tcactccgcatctcagcggaatccgtgtggctacccgacgtggtgctcctaaacaataac
gatggaaattttgatgttgctctggacatcaacgtcgtggtgtcctccgacggctccatg
cgctggcagcccccgggcatctatcgcagcagctgcagcatccaggtcacctacttcccc
tttgactggcagaactgcaccatggtgttcagttcctatagctatgacagctcagaggtc
agcctgcaaactggcttgagtcctgaggggcaggagcggcaggaagtgtatattcatgaa
gggacctttattgagaatggccaatgggagattatccacaagccttctcggctaattcag
ccttcagtggatcctaggggaggcggggaaggacgacgtgaagaagtcaccttctacctc
atcattcgccggaagcctctcttttacctggtcaacgtcattgccccatgcatcctcatc
actctcctggccatctttgtcttctacctgccaccggatgcaggagagaagatggggctc
tccatctttgccctgttgaccctcactgtgttcctgctgctgctggcagacaaagtacct
gagacctccctgtctgtccccatcattatcaagtacctcatgttcaccatggtcctcgtc
accttctcagtcatccttagtgttgtggtcctcaacttgcaccatcgctcaccccacacc
caccaaatgcccctttgggttcgtcagatctttatccacaaactccctctgtacctgggt
ctgaagaggcccaaacctgagagagaccagatgcaggagccaccttccatagctcccagg
gattctccaggaagtggctggggtcggggaacagatgaatatttcatccgcaagccacca
aatgattttctcttccccaaacccaacaggttccagcctgaactgtctgctccagacctg
cggcgatttatcgatggtccaaaccgggctgtgggtctccctcctgagctacgggaggtc
gtttcttcgatcagctacatcgctcgacagctgcaggaacaggaagaccatgacgtgctg
aaggaggactggcaatttgtggccatggtagtggaccgcctcttcctatggaccttcatc
atcttcacgagcgttgggaccctcgtcatctttctggatgccacgtaccacttgcccccc
gccgacccttttccttga

DBGET integrated database retrieval system