KEGG   Bos taurus (cow): 282188Help
Entry
282188            CDS       T01008                                 

Gene name
COL1A2
Definition
(RefSeq) collagen alpha-2(I) chain precursor
  KO
K06236  collagen, type I, alpha
Organism
bta  Bos taurus (cow)
Pathway
bta04151  PI3K-Akt signaling pathway
bta04510  Focal adhesion
bta04512  ECM-receptor interaction
bta04611  Platelet activation
bta04926  Relaxin signaling pathway
bta04933  AGE-RAGE signaling pathway in diabetic complications
bta04974  Protein digestion and absorption
bta05146  Amoebiasis
bta05165  Human papillomavirus infection
bta05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    282188 (COL1A2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    282188 (COL1A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    282188 (COL1A2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    282188 (COL1A2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    282188 (COL1A2)
  09154 Digestive system
   04974 Protein digestion and absorption
    282188 (COL1A2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    282188 (COL1A2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    282188 (COL1A2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    282188 (COL1A2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    282188 (COL1A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bta00536]
    282188 (COL1A2)
Glycosaminoglycan binding proteins [BR:bta00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   282188 (COL1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen COLFI
Motif
Other DBs
NCBI-GeneID: 282188
NCBI-ProteinID: NP_776945
BGD-bta: BT12259
Ensembl: ENSBTAG00000013472
VGNC: 27561
UniProt: P02465
Position
4
AA seq 1364 aa AA seqDB search
MLSFVDTRTLLLLAVTSCLATCQSLQEATARKGPSGDRGPRGERGPPGPPGRDGDDGIPG
PPGPPGPPGPPGLGGNFAAQFDAKGGGPGPMGLMGPRGPPGASGAPGPQGFQGPPGEPGE
PGQTGPAGARGPPGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGH
NGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGP
VGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGA
NGLPGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGE
PGAVGQPGPPGPSGEEGKRGSTGEIGPAGPPGPPGLRGNPGSRGLPGADGRAGVMGPAGS
RGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGSPGNIGPAGKEGPVGLPGIDGRPGPIGP
AGARGEPGNIGFPGPKGPSGDPGKAGEKGHAGLAGARGAPGPDGNNGAQGPPGLQGVQGG
KGEQGPAGPPGFQGLPGPAGTAGEAGKPGERGIPGEFGLPGPAGARGERGPPGESGAAGP
TGPIGSRGPSGPPGPDGNKGEPGVVGAPGTAGPSGPSGLPGERGAAGIPGGKGEKGETGL
RGDIGSPGRDGARGAPGAIGAPGPAGANGDRGEAGPAGPAGPAGPRGSPGERGEVGPAGP
NGFAGPAGAAGQPGAKGERGTKGPKGENGPVGPTGPVGAAGPSGPNGPPGPAGSRGDGGP
PGATGFPGAAGRTGPPGPSGISGPPGPPGPAGKEGLRGPRGDQGPVGRSGETGASGPPGF
VGEKGPSGEPGTAGPPGTPGPQGLLGAPGFLGLPGSRGERGLPGVAGSVGEPGPLGIAGP
PGARGPPGNVGNPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKGERGYPGNAGPVGAAGA
PGPQGPVGPVGKHGNRGEPGPAGAVGPAGAVGPRGPSGPQGIRGDKGEPGDKGPRGLPGL
KGHNGLQGLPGLAGHHGDQGAPGAVGPAGPRGPAGPSGPAGKDGRIGQPGAVGPAGIRGS
QGSQGPAGPPGPPGPPGPPGPSGGGYEFGFDGDFYRADQPRSPTSLRPKDYEVDATLKSL
NNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGET
CIRAQPEDIPVKNWYRNSKAKKHVWVGETINGGTQFEYNVEGVTTKEMATQLAFMRLLAN
HASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTN
EWQKTIIEYKTNKPSRLPILDIAPLDIGGADQEIRLNIGPVCFK
NT seq 4095 nt NT seq  +upstreamnt  +downstreamnt
atgctcagctttgtggatacgcggactttgttgctgcttgcagtaacttcgtgcctagca
acatgccaatccttacaagaggcaactgcaagaaagggcccaagtggagatagaggacca
cgcggagaaaggggtccaccaggcccaccaggcagagatggtgatgacggcatcccaggc
cctcctggcccccctggccctcctggcccccctggtcttggcgggaactttgctgctcag
tttgatgcaaaaggaggtggccctggaccaatggggctgatgggacctcgcggccctcct
ggggcttctggagcccctggccctcaaggtttccagggacctccgggtgagcctggtgaa
cctggtcagactggtcctgcaggtgctcgtggcccgcctggccctcctggcaaggctggt
gaggatggtcaccctggaaaacctggacgacctggtgagagaggggttgttggaccacag
ggtgctcgtggctttcctggaactcctggactccctggcttcaagggcattaggggtcac
aatggtctggatggattgaagggacagcctggtgctccaggtgtgaagggtgaacctggt
gcccctggtgaaaatggaactccaggtcaaacgggagcccgtggtcttcctggtgagaga
ggacgtgttggtgcccctggcccagctggtgcccgtggaagtgatggaagtgtgggtcct
gtgggccctgctggtcccattgggtctgctggccctccaggcttcccaggtgctcctggc
cccaagggtgaactcggacctgttggtaaccctggccctgctggtcccgcgggtccccgt
ggtgaagtgggtctcccaggcctttctggccctgtcggacctcctggaaaccccggagcc
aatgggcttcctggcgctaagggtgctgctggccttcccggtgttgctggggctcccggc
ctccctggaccccggggtattcctggccctgttggcgctgctggtgctactggcgccaga
ggacttgttggtgagcccggcccagctggttcgaaaggagagagcggcaacaagggcgag
cctggtgctgttgggcagccaggtcctcctggccccagtggtgaagaaggaaagagaggc
tccactggagaaatcggacccgctggccccccaggacctcctgggctgaggggaaatcct
ggctcccgtggtctacctggagctgacggcagagctggtgtcatgggtcctgctggtagc
cgtggtgcaactggccctgctggtgtgcgaggtcccaatggagattctggtcgccctgga
gagcctggcctcatgggaccccgaggtttcccaggttcccctggaaatatcggcccagct
ggtaaagaaggtcctgtgggtctccctggtattgacggcagacctgggcccattggccca
gcgggagcaagaggagagcctggcaacattggattccctggacccaaaggccccagtggt
gatcctggcaaagctggtgaaaaaggtcatgctggtcttgctggtgctcggggcgctcca
ggtcccgatggcaacaacggtgctcagggaccccctggactacagggtgtccaaggtgga
aaaggtgaacagggtcctgctggtcctccaggcttccagggtctgcctggccctgcaggc
acagctggtgaagctggcaaaccaggagaaaggggtatccctggtgaatttggtctccct
ggccctgctggtgcaagaggggagcgggggcccccaggtgaaagtggtgctgctgggcct
actgggcctattggaagccgaggtccttctggacccccagggcctgatggaaacaagggt
gaaccgggtgtggttggcgctccaggcactgctggcccatctggtcctagcggactccca
ggagagaggggtgcggctggcattcctggaggcaagggagaaaagggtgaaactggtctc
agaggtgacattggtagccctggtagagatggtgctcgtggtgctcctggtgctattggt
gctcctggccctgctggagccaatggggaccggggtgaagctggtcccgctggccctgct
ggccctgctggtcctcgtggtagccctggtgaacgtggtgaggtcggtcccgctggcccc
aacggatttgctggtcctgctggtgctgctggtcaacctggtgctaaaggagagagagga
accaaaggacccaagggtgaaaatggtcctgttggtcccacaggccccgttggagctgcc
ggtccgtctggtccaaatggcccacctggtcctgctggaagtcgtggtgatggagggccc
cctggggctactggtttccctggtgctgctggacggactggtccccctggaccctctggt
atctctggcccccctggcccccctggtcctgctggtaaagaagggcttcgtgggcctcgt
ggtgaccaaggtccagttggtcgaagtggagagacaggtgcctctggccctcctggcttt
gttggtgagaagggtccctctggagagcctggtactgctgggcctcctggaaccccaggt
ccacaaggccttcttggtgctcctggttttctgggtctcccaggctctagaggtgagcgt
ggtctaccaggtgtcgctggatctgtgggtgaacctggccccctcggcatcgcaggccca
cctggggcccgtggtccccctggtaatgtcggtaatcctggcgtcaatggtgctcctggt
gaagccggtcgtgacggcaaccctgggaatgacggtcccccaggccgcgatggtcaaccc
ggacacaagggggagcgtggttaccccggtaacgcaggtcctgttggtgctgccggtgct
cctggccctcaaggccctgtgggtcccgttggtaaacacggaaaccgtggtgaaccgggt
cctgccggtgctgttggtcctgctggtgccgttggcccaagaggtcccagtggcccacaa
ggtattcgaggtgacaagggagagcctggtgataagggtcccagaggtcttcctggctta
aagggacacaatgggttgcaaggtctcccgggtcttgctggtcatcatggcgatcaaggt
gctcccggtgctgtgggtcccgctggtcccaggggccctgctggtccttctggccccgct
ggcaaagacggtcgcattggacagcctggtgcagtcggacctgctggcattcgtggctct
cagggtagccaaggtcctgctggccctcctggtccccctggccctcctggacctcctggc
ccaagtggtggtggttacgagtttggttttgatggagacttctacagggctgaccagcct
cgctcaccaacttctctcagacccaaggattatgaagttgatgctactctgaaatctctc
aacaaccagattgagacccttcttactccagaaggctctaggaagaacccagctcgcaca
tgccgagacttgagactcagccacccagaatggagcagtggttactactggattgaccct
aaccaaggatgtactatggatgctatcaaagtatactgtgatttctctactggcgaaacc
tgcatccgggctcaacctgaagacatcccagtcaagaactggtacagaaattccaaggcc
aagaagcatgtctgggtaggagaaactatcaacggtggtacccagtttgaatataatgtt
gaaggagtaaccaccaaggaaatggctacccaacttgccttcatgcgtctgctggccaac
catgcctctcagaacatcacctaccattgcaagaacagcattgcatacatggatgaggaa
actggcaacctgaaaaaggctgtcattctgcaaggatccaatgatgtcgaacttgttgcc
gagggcaacagcagattcacttacactgttcttgtagatggctgctctaaaaagacaaat
gaatggcagaagacaatcattgaatataaaacaaacaagccatctcgcctgcctatcctt
gatattgcacctttggacatcggtggcgctgaccaagaaatcagattgaacattggccca
gtctgtttcaaataa

DBGET integrated database retrieval system