KEGG   Bos taurus (cow): 282205
Entry
282205            CDS       T01008                                 
Symbol
CRYBB1
Name
(RefSeq) beta-crystallin B1
  KO
K23482  beta-crystallin
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    282205 (CRYBB1)
SSDB
Motif
Pfam: Crystall Inhibitor_I36
Other DBs
NCBI-GeneID: 282205
NCBI-ProteinID: NP_776951
Ensembl: ENSBTAG00000019280
VGNC: 27736
UniProt: P07318
Position
17:complement(66251958..66265139)
AA seq 253 aa
MSQPAAKASATAAVNPGPDGKGKAGPPPGPAPGSGPAPAPAPAPAQPAPAAKAELPPGSY
KLVVFEQENFQGRRVEFSGECLNLGDRGFERVRSIIVTSGPWVAFEQSNFRGEMFVLEKG
EYPRWDTWSSSYRSDRLMSFRPIKMDAQEHKLCLFEGANFKGNTMEIQEDDVPSLWVYGF
CDRVGSVRVSSGTWVGYQYPGYRGYQYLLEPGDFRHWNEWGAFQPQMQAVRRLRDRQWHR
EGCFPVLAAEPPK
NT seq 762 nt   +upstreamnt  +downstreamnt
atgtcccagcccgcggccaaggcctcggccaccgccgccgtgaacccagggcccgacggg
aaggggaaggcgggcccacccccaggccccgccccgggatccggccccgcccccgccccc
gccccggccccagcccagccggcgcccgcggccaaagcggagctgcctcccggcagctac
aagctggtggtctttgagcaggagaacttccagggccggcgggtggaattctccggggag
tgcttgaacctgggagaccgtggcttcgaacgagtgcgcagcatcattgtcacctccgga
ccctgggtcgcatttgagcagtccaacttccggggggagatgttcgtcctggagaaaggc
gagtacccacgctgggacacgtggtccagcagctaccgcagcgaccggctcatgtccttc
cggcccatcaagatggatgcccaggagcacaagctctgcctgtttgaaggggccaacttc
aaaggcaacaccatggagatccaggaggatgatgtgcccagcctctgggtctatggcttc
tgtgaccgcgtgggcagcgtgagggtctccagcggaacctgggttggctaccagtatccc
ggctaccgtgggtaccagtacctcctggagcctggcgacttccggcactggaacgagtgg
ggggccttccagccacagatgcaggccgtgcgtcgcctgcgtgaccggcagtggcatcgc
gaaggctgtttccccgtcctggccgccgagccgcccaagtga

DBGET integrated database retrieval system