KEGG   Bos taurus (cow): 282217Help
Entry
282217            CDS       T01008                                 

Gene name
DNASE1
Definition
(RefSeq) deoxyribonuclease-1 precursor
  KO
K11994  deoxyribonuclease-1 [EC:3.1.21.1]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    282217 (DNASE1)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.1  deoxyribonuclease I
     282217 (DNASE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exo_endo_phos
Motif
Other DBs
NCBI-GeneID: 282217
NCBI-ProteinID: NP_776959
BGD-bta: BT26610
Ensembl: ENSBTAG00000020107
VGNC: 28132
UniProt: P00639 M5FJR2
Structure
PDB: 

Position
25
AA seq 282 aa AA seqDB search
MRGTRLMGLLLALAGLLQLGLSLKIAAFNIRTFGETKMSNATLASYIVRIVRRYDIVLIQ
EVRDSHLVAVGKLLDYLNQDDPNTYHYVVSEPLGRNSYKERYLFLFRPNKVSVLDTYQYD
DGCESCGNDSFSREPAVVKFSSHSTKVKEFAIVALHSAPSDAVAEINSLYDVYLDVQQKW
HLNDVMLMGDFNADCSYVTSSQWSSIRLRTSSTFQWLIPDSADTTATSTNCAYDRIVVAG
SLLQSSVVPGSAAPFDFQAAYGLSNEMALAISDHYPVEVTLT
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaggggcaccaggctgatggggctgctgctcgccctcgctggtctgctgcagctgggc
ttgtccctgaagatagcagccttcaacatccgcacctttggggagaccaagatgtccaat
gctacgctcgccagctacattgttcggatcgtgcgtcgttacgacatcgtcctcatccag
gaggtcagagacagccacctggtggctgtggggaagctcctggactatctcaaccaggat
gacccaaacacctaccactatgtggtcagtgagccgctgggccgcaacagctacaaggag
cgctacctctttctgttcagacccaacaaggtgtccgtgctggacacctaccagtacgac
gacggctgcgagtcctgcgggaacgacagcttcagccgggagcccgctgtggtcaagttc
tcatcccactccaccaaggtcaaggaatttgccattgttgccctgcactcggccccatcg
gacgcagtggctgagattaattctctctacgatgtctacctggatgtccagcagaagtgg
cacttgaacgatgtcatgttgatgggcgatttcaatgctgactgcagctacgtgacctcc
tcgcagtggtcatccatccgcctgcgtacgagctccaccttccagtggctgattcctgac
agtgccgacaccacggctacgtccacgaactgcgcctatgacaggatcgtggtcgcaggg
tctctgctccagagttctgtggttcctggctcggccgctccctttgacttccaagctgca
tacggactgagcaatgagatggccctggccatcagtgaccattacccggtggaggtgacg
ctgacataa

DBGET integrated database retrieval system