KEGG   Bos taurus (cow): 282220
Entry
282220            CDS       T01008                                 

Gene name
EEF1A1
Definition
(RefSeq) elongation factor 1-alpha 1
  KO
K03231  elongation factor 1-alpha
Organism
bta  Bos taurus (cow)
Pathway
bta03013  Nucleocytoplasmic transport
bta05134  Legionellosis
bta05140  Leishmaniasis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    282220 (EEF1A1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    282220 (EEF1A1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    282220 (EEF1A1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bta03019]
    282220 (EEF1A1)
   03016 Transfer RNA biogenesis [BR:bta03016]
    282220 (EEF1A1)
   03012 Translation factors [BR:bta03012]
    282220 (EEF1A1)
   04131 Membrane trafficking [BR:bta04131]
    282220 (EEF1A1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    282220 (EEF1A1)
Messenger RNA biogenesis [BR:bta03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     282220 (EEF1A1)
Transfer RNA biogenesis [BR:bta03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    282220 (EEF1A1)
Translation factors [BR:bta03012]
 Eukaryotic type
  Elongation factors
   282220 (EEF1A1)
Membrane trafficking [BR:bta04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    282220 (EEF1A1)
Exosome [BR:bta04147]
 Exosomal proteins
  Proteins found in most exosomes
   282220 (EEF1A1)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 GTP_EFTU_D4 Gtr1_RagA G-alpha
Other DBs
NCBI-GeneID: 282220
NCBI-ProteinID: NP_776960
BGD-bta: BT15663
Ensembl: ENSBTAG00000014534
UniProt: P68103
Position
9
AA seq 462 aa
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKK
IGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTR
PTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALS
EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPV
LDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP
LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgggaaaggagaagacccacatcaacatcgttgtcattgggcacgtagattcagggaag
tctaccacgactggccatctgatctataaatgtggcgggatcgacaagagaacaattgaa
aagttcgagaaggaggctgccgagatgggaaagggctccttcaaatatgcctgggtcttg
gacaaacttaaagctgaacgtgagcgtggtatcaccattgatatctccctgtggaaattt
gagaccagcaagtactatgttaccatcattgatgccccaggacacagagacttcatcaaa
aacatgattacaggcacatcccaggctgactgtgctgtcctgatcgttgctgctggtgtt
ggtgaatttgaagccggtatctccaagaacgggcagacccgtgagcatgcccttttggct
tacaccctgggtgtgaaacaactaattgttggcgttaacaaaatggattccactgagcca
ccctatagccagaagagatacgaagaaattgttaaggaagtcagcacctatattaagaaa
attggctacaaccccgacacagtagcatttgtgccaatttctggctggaatggtgacaac
atgctagaaccaagtgctaatatgccatggttcaagggatggaaagtcacccgtaaggac
ggcaatgccagtggaaccaccctgcttgaagctctggattgcattctgccaccaactcgc
ccaactgacaaacccttgcgtttgcctctccaggatgtctataaaattggtggtattggt
actgtccctgtgggtcgtgtggagactggtgttctcaaacctggcatggtggtcaccttt
gctccagtcaatgtaacaactgaagtgaagtctgtagaaatgcaccatgaagcattgagt
gaagcccttcctggggacaatgtgggctttaatgtcaaaaacgtgtctgtcaaagatgtc
cgtcgtggcaatgtggctggtgacagcaaaaatgatccacccatggaagctgctggcttc
acagctcaggtgattattttgaaccatccaggccaaatcagtgctggatatgcacctgtg
ctggattgtcacacagctcacattgcttgcaagtttgctgagctgaaggagaagattgat
cgtcgttctgggaaaaagctggaagatggccctaaattcttgaaatctggtgacgctgcc
atcgttgatatggttcctggcaagcccatgtgtgtcgagagcttctctgattatcctccc
ctgggccgttttgctgtgcgtgacatgagacagacagtcgctgtgggtgtcatcaaagca
gtggacaagaaggcagctggagctggcaaggtcaccaagtctgcccagaaagctcagaag
gctaaatga

DBGET integrated database retrieval system