KEGG   Bos taurus (cow): 282254Help
Entry
282254            CDS       T01008                                 

Gene name
HSPA1A
Definition
(RefSeq) heat shock 70 kDa protein 1B
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
bta  Bos taurus (cow)
Pathway
bta03040  Spliceosome
bta04010  MAPK signaling pathway
bta04141  Protein processing in endoplasmic reticulum
bta04144  Endocytosis
bta04213  Longevity regulating pathway - multiple species
bta04612  Antigen processing and presentation
bta04915  Estrogen signaling pathway
bta05134  Legionellosis
bta05145  Toxoplasmosis
bta05162  Measles
Brite
KEGG Orthology (KO) [BR:bta00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    282254 (HSPA1A)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    282254 (HSPA1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    282254 (HSPA1A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    282254 (HSPA1A)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    282254 (HSPA1A)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    282254 (HSPA1A)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    282254 (HSPA1A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    282254 (HSPA1A)
  09172 Infectious disease: viral
   05162 Measles
    282254 (HSPA1A)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    282254 (HSPA1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bta01009]
    282254 (HSPA1A)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bta03041]
    282254 (HSPA1A)
   03009 Ribosome biogenesis [BR:bta03009]
    282254 (HSPA1A)
   03110 Chaperones and folding catalysts [BR:bta03110]
    282254 (HSPA1A)
   04131 Membrane trafficking [BR:bta04131]
    282254 (HSPA1A)
   03051 Proteasome [BR:bta03051]
    282254 (HSPA1A)
   03029 Mitochondrial biogenesis [BR:bta03029]
    282254 (HSPA1A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    282254 (HSPA1A)
Protein phosphatases and associated proteins [BR:bta01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     282254 (HSPA1A)
Spliceosome [BR:bta03041]
 Complex B
  Other components
   Prp19 complex
    282254 (HSPA1A)
 Complex C
   Prp19-CDC5 complex
    282254 (HSPA1A)
Ribosome biogenesis [BR:bta03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    282254 (HSPA1A)
Chaperones and folding catalysts [BR:bta03110]
 Heat shock proteins
  HSP70 / DNAK
   282254 (HSPA1A)
Membrane trafficking [BR:bta04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    282254 (HSPA1A)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    282254 (HSPA1A)
Proteasome [BR:bta03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    282254 (HSPA1A)
Mitochondrial biogenesis [BR:bta03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    282254 (HSPA1A)
Exosome [BR:bta04147]
 Exosomal proteins
  Proteins found in most exosomes
   282254 (HSPA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Motif
Other DBs
NCBI-GeneID: 282254
NCBI-ProteinID: NP_976067
Ensembl: ENSBTAG00000025441
UniProt: Q27975 Q27965
Position
23
AA seq 641 aa AA seqDB search
MAKNMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFRVINDGDKPKVQVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKN
ALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE
QVCNPIISRLYQGAGGPGAGGFGAQGPKGGSGSGPTIEEVD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaacatggctatcggcatcgacctgggcaccacctactcctgcgtaggggtg
ttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacccccagc
tacgtggccttcaccgataccgagcggctcatcggggatgcggccaagaaccaggtggcg
ctgaacccgcagaacacggtgttcgacgcgaagcggctgatcggccgcaagttcggagac
ccggtggtgcagtcggacatgaagcactggcctttccgcgtcatcaacgacggagacaag
cctaaggtgcaggtgagctacaaaggggagaccaaggcgttctacccggaggagatctcg
tcgatggtgctgaccaagatgaaggagatcgccgaggcgtacctgggccacccggtgacc
aacgcggtgatcaccgtgccggcctacttcaacgactcgcagcggcaggccaccaaggac
gcgggggtgatcgcggggctgaacgtgctgaggatcatcaacgagcccacggccgccgcc
atcgcctacggcctggacaggacgggcaagggggagcgcaacgtgctcatctttgatctg
ggagggggcacgttcgacgtgtccatcctgacgatcgacgacggcatcttcgaggtgaag
gccacggccggggacacgcacctgggcggggaggacttcgacaacaggctggtgaaccac
ttcgtggaggagttcaagaggaagcacaagaaggacatcagccagaacaagcgggccgtg
aggcggctgcgcaccgcatgcgagcgggccaagagaaccttgtcgtccagcacccaggcc
agcctggagatcgactccctgttcgagggcatcgacttctacacgtccatcaccagggcg
cggttcgaggagctgtgctccgacctgttccggagcaccctggagcccgtggagaaggcg
ctacgcgacgccaagctggacaaggcgcagatccacgacctggtcctggtggggggctcc
acccgcatccccaaggtgcagaagctgctgcaggacttcttcaacgggcgcgacctcaac
aagagcatcaaccccgacgaggcggtggcgtacggggcggcggtgcaggcggccatcctg
atgggggacaagtcggagaacgtgcaggacctgctgttgctggacgtggctcccctgtcg
ctgggactggagacggccggaggcgtgatgaccgccctgatcaagcgcaactccaccatc
cccacgaagcagacgcagatcttcaccacctactcggacaaccagccgggcgtgctgatc
caggtgtacgagggcgagagggccatgacgcgggacaacaacctgctggggcgcttcgag
ctgagcggcatcccgccggccccgcggggggtgccccagatcgaggtgaccttcgacatc
gacgccaatggcatcctgaacgtcacggccacggacaagagcacgggcaaggccaacaag
atcaccatcaccaacgacaagggccggctgagcaaggaggagatcgagcgcatggtgcag
gaggcggaaaagtacaaggcggaggacgaggtccagcgcgagagggtgtctgccaagaac
gcgctggagtcgtacgccttcaacatgaagagcgccgtggaggatgaggggctgaagggc
aagatcagcgaggcggacaagaagaaggtgctggacaagtgccaggaggtgatttcctgg
ctggacgccaacaccttggcggagaaggacgagtttgagcacaagaggaaggagctggag
caggtgtgtaaccccatcatcagcagactgtaccagggggcgggcggccccggggctggc
ggctttggggctcagggccctaaagggggctctgggtctggccccaccattgaggaggtg
gattag

DBGET integrated database retrieval system