KEGG   Bos taurus (cow): 282261Help
Entry
282261            CDS       T01008                                 

Gene name
IGFBP3
Definition
(RefSeq) insulin-like growth factor-binding protein 3 precursor
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
bta  Bos taurus (cow)
Pathway
bta04115  p53 signaling pathway
bta04218  Cellular senescence
bta05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    282261 (IGFBP3)
   04218 Cellular senescence
    282261 (IGFBP3)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    282261 (IGFBP3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    282261 (IGFBP3)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   282261 (IGFBP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thyroglobulin_1 IGFBP
Motif
Other DBs
NCBI-GeneID: 282261
NCBI-ProteinID: NP_776981
BGD-bta: BT10043
Ensembl: ENSBTAG00000003994
VGNC: 30085
UniProt: P20959 I6XXP7
Position
4
AA seq 291 aa AA seqDB search
MLRARPALWAAALTALTLLRGPPAARAGAGTMGAGPVVRCEPCDARAVAQCAPPPPSPPC
AELVREPGCGCCLTCALREGQPCGVYTERCGSGLRCQPPPGDPRPLQALLDGRGLCANAS
AVGRLRPYLLPSASGNGSESEEDHSMGSTENQAGPSTHRVPVSKFHPIHTKMDVIKKGHA
KDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNMLSPRGIHIPNC
DKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGFDVKGKGDVHCYSMESK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgggcacgccccgcgctctgggctgcggctttgaccgcactgacgttgctccgc
ggaccgccggcggcacgagctggggcgggcacgatgggcgccggcccagtggtgcgctgc
gagccgtgcgacgcgcgtgccgttgcccagtgcgcgccgccgcccccctcgcccccgtgc
gccgagctggtgcgcgagccgggctgcggttgctgtctcacgtgcgcgctgcgcgagggt
cagccttgcggcgtctacaccgagcgctgtggctccggcctccgctgccagccgccgcct
ggcgatccgcgcccgctacaagcgttgttggacggccgcgggctctgcgccaacgccagc
gccgtcggccgcctgcgcccttacctgctaccgtccgcgtcaggaaatggcagtgagtcg
gaagaagaccacagcatggggagcacagagaaccaggctggccccagcacacaccgggtg
cccgtctccaaattccaccccatccacaccaagatggatgtcatcaagaaaggtcatgcc
aaggacagccagcgctacaaggttgactacgagtctcagagcacagacacccagaacttc
tcctctgagtccaagcgtgagacagaatacgggccctgccgccgggaaatggaagacacg
ctgaaccacctcaagttcctgaacatgctcagccccaggggcatccacattcccaactgc
gacaagaagggcttttacaagaaaaagcagtgccgcccttccaagggcaggaagcggggt
ttctgctggtgtgtggataagtacgggcagcccctcccgggcttcgacgtgaaggggaaa
ggggacgtgcactgctacagcatggagagcaagtag

DBGET integrated database retrieval system