KEGG   Bos taurus (cow): 282322Help
Entry
282322            CDS       T01008                                 

Gene name
PRKACA
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
bta  Bos taurus (cow)
Pathway
bta01522  Endocrine resistance
bta04010  MAPK signaling pathway
bta04014  Ras signaling pathway
bta04020  Calcium signaling pathway
bta04024  cAMP signaling pathway
bta04062  Chemokine signaling pathway
bta04114  Oocyte meiosis
bta04140  Autophagy - animal
bta04211  Longevity regulating pathway
bta04213  Longevity regulating pathway - multiple species
bta04261  Adrenergic signaling in cardiomyocytes
bta04270  Vascular smooth muscle contraction
bta04310  Wnt signaling pathway
bta04340  Hedgehog signaling pathway
bta04371  Apelin signaling pathway
bta04530  Tight junction
bta04540  Gap junction
bta04611  Platelet activation
bta04713  Circadian entrainment
bta04714  Thermogenesis
bta04720  Long-term potentiation
bta04723  Retrograde endocannabinoid signaling
bta04724  Glutamatergic synapse
bta04725  Cholinergic synapse
bta04726  Serotonergic synapse
bta04727  GABAergic synapse
bta04728  Dopaminergic synapse
bta04740  Olfactory transduction
bta04742  Taste transduction
bta04750  Inflammatory mediator regulation of TRP channels
bta04910  Insulin signaling pathway
bta04911  Insulin secretion
bta04912  GnRH signaling pathway
bta04913  Ovarian steroidogenesis
bta04914  Progesterone-mediated oocyte maturation
bta04915  Estrogen signaling pathway
bta04916  Melanogenesis
bta04918  Thyroid hormone synthesis
bta04919  Thyroid hormone signaling pathway
bta04921  Oxytocin signaling pathway
bta04922  Glucagon signaling pathway
bta04923  Regulation of lipolysis in adipocytes
bta04924  Renin secretion
bta04925  Aldosterone synthesis and secretion
bta04926  Relaxin signaling pathway
bta04927  Cortisol synthesis and secretion
bta04928  Parathyroid hormone synthesis, secretion and action
bta04934  Cushing's syndrome
bta04961  Endocrine and other factor-regulated calcium reabsorption
bta04962  Vasopressin-regulated water reabsorption
bta04970  Salivary secretion
bta04971  Gastric acid secretion
bta04976  Bile secretion
bta05012  Parkinson's disease
bta05020  Prion diseases
bta05030  Cocaine addiction
bta05031  Amphetamine addiction
bta05032  Morphine addiction
bta05146  Amoebiasis
bta05165  Human papillomavirus infection
bta05166  HTLV-I infection
bta05169  Epstein-Barr virus infection
bta05200  Pathways in cancer
bta05203  Viral carcinogenesis
bta05205  Proteoglycans in cancer
bta05414  Dilated cardiomyopathy (DCM)
Module
bta_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    282322 (PRKACA)
   04010 MAPK signaling pathway
    282322 (PRKACA)
   04310 Wnt signaling pathway
    282322 (PRKACA)
   04340 Hedgehog signaling pathway
    282322 (PRKACA)
   04371 Apelin signaling pathway
    282322 (PRKACA)
   04020 Calcium signaling pathway
    282322 (PRKACA)
   04024 cAMP signaling pathway
    282322 (PRKACA)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    282322 (PRKACA)
  Cell growth and death
   04114 Oocyte meiosis
    282322 (PRKACA)
  Cellular community - eukaryotes
   04530 Tight junction
    282322 (PRKACA)
   04540 Gap junction
    282322 (PRKACA)
 Organismal Systems
  Immune system
   04611 Platelet activation
    282322 (PRKACA)
   04062 Chemokine signaling pathway
    282322 (PRKACA)
  Endocrine system
   04911 Insulin secretion
    282322 (PRKACA)
   04910 Insulin signaling pathway
    282322 (PRKACA)
   04922 Glucagon signaling pathway
    282322 (PRKACA)
   04923 Regulation of lipolysis in adipocyte
    282322 (PRKACA)
   04912 GnRH signaling pathway
    282322 (PRKACA)
   04913 Ovarian Steroidogenesis
    282322 (PRKACA)
   04915 Estrogen signaling pathway
    282322 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    282322 (PRKACA)
   04921 Oxytocin signaling pathway
    282322 (PRKACA)
   04926 Relaxin signaling pathway
    282322 (PRKACA)
   04918 Thyroid hormone synthesis
    282322 (PRKACA)
   04919 Thyroid hormone signaling pathway
    282322 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    282322 (PRKACA)
   04916 Melanogenesis
    282322 (PRKACA)
   04924 Renin secretion
    282322 (PRKACA)
   04925 Aldosterone synthesis and secretion
    282322 (PRKACA)
   04927 Cortisol synthesis and secretion
    282322 (PRKACA)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    282322 (PRKACA)
   04270 Vascular smooth muscle contraction
    282322 (PRKACA)
  Digestive system
   04970 Salivary secretion
    282322 (PRKACA)
   04971 Gastric acid secretion
    282322 (PRKACA)
   04976 Bile secretion
    282322 (PRKACA)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    282322 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    282322 (PRKACA)
  Nervous system
   04724 Glutamatergic synapse
    282322 (PRKACA)
   04727 GABAergic synapse
    282322 (PRKACA)
   04725 Cholinergic synapse
    282322 (PRKACA)
   04728 Dopaminergic synapse
    282322 (PRKACA)
   04726 Serotonergic synapse
    282322 (PRKACA)
   04720 Long-term potentiation
    282322 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    282322 (PRKACA)
  Sensory system
   04740 Olfactory transduction
    282322 (PRKACA)
   04742 Taste transduction
    282322 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    282322 (PRKACA)
  Aging
   04211 Longevity regulating pathway - mammal
    282322 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    282322 (PRKACA)
  Environmental adaptation
   04713 Circadian entrainment
    282322 (PRKACA)
   04714 Thermogenesis
    282322 (PRKACA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    282322 (PRKACA)
   05205 Proteoglycans in cancer
    282322 (PRKACA)
   05203 Viral carcinogenesis
    282322 (PRKACA)
  Neurodegenerative diseases
   05012 Parkinson's disease
    282322 (PRKACA)
   05020 Prion diseases
    282322 (PRKACA)
  Substance dependence
   05030 Cocaine addiction
    282322 (PRKACA)
   05031 Amphetamine addiction
    282322 (PRKACA)
   05032 Morphine addiction
    282322 (PRKACA)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    282322 (PRKACA)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    282322 (PRKACA)
  Infectious diseases
   05166 HTLV-I infection
    282322 (PRKACA)
   05169 Epstein-Barr virus infection
    282322 (PRKACA)
   05165 Human papillomavirus infection
    282322 (PRKACA)
   05146 Amoebiasis
    282322 (PRKACA)
  Drug resistance
   01522 Endocrine resistance
    282322 (PRKACA)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     282322 (PRKACA)
Protein kinases [BR:bta01001]
 Serine/threonine kinases: AGC group
  PKA family
   282322 (PRKACA)
Messenger RNA biogenesis [BR:bta03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     282322 (PRKACA)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    282322 (PRKACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 282322
NCBI-ProteinID: NP_777009
BGD-bta: BT12357
Ensembl: ENSBTAG00000006642
VGNC: 50146
UniProt: P00517
Structure
PDB: 

Position
7
AA seq 351 aa AA seqDB search
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgccgccgccgccaagaagggcagcgagcaagaaagcgtgaaagagttctta
gccaaagccaaagaagattttcttaaaaaatgggaaaatcctgctcagaacacagcccac
ttggatcagtttgaacgaatcaagaccctgggtacgggctccttcgggcgggtgatgctg
gtgaagcacatggagaccgggaaccactacgccatgaagatcctcgacaaacagaaggtg
gtgaagctgaaacagattgagcacaccctgaatgagaagcgcatcctgcaggcggtcaac
tttccgttccttgtcaaactcgagttctccttcaaggacaactcaaatttatacatggtc
atggagtacgtgcccggtggggagatgttctcacacctgcgacggatcgggaggttcagt
gagccccacgcacgcttctacgccgcccagattgtcctgacctttgagtacctgcactcg
cttgatctcatttaccgggacctgaagccagagaacctcctcatcgaccagcagggctac
attcaggtgacagactttggtttcgccaagcgtgtgaaaggccgcacctggaccttgtgt
gggacccctgagtacttggcccccgagatcatcctgagtaaaggctacaacaaagctgtg
gactggtgggccctgggggtcctcatctacgaaatggccgcaggctacccgcccttcttt
gccgaccagcccatccagatctacgagaagattgtctctgggaaggtgcggtttccatcc
cacttcagctctgacttgaaggatctgctgcgcaacctcctacaagtggacctcaccaag
cgctttgggaacctcaagaatggggtcaatgatatcaagaaccacaagtggtttgccaca
actgactggattgccatctaccagaggaaggtggaagctcccttcataccaaagtttaaa
ggccctggggacacaagtaactttgacgactatgaggaggaagagatccgagtctctatc
aatgagaagtgtggcaaggagttttctgagttctag

DBGET integrated database retrieval system