KEGG   Bos taurus (cow): 282323Help
Entry
282323            CDS       T01008                                 

Gene name
PRKACB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
bta  Bos taurus (cow)
Pathway
bta01522  Endocrine resistance
bta04010  MAPK signaling pathway
bta04014  Ras signaling pathway
bta04020  Calcium signaling pathway
bta04024  cAMP signaling pathway
bta04062  Chemokine signaling pathway
bta04114  Oocyte meiosis
bta04140  Autophagy - animal
bta04211  Longevity regulating pathway
bta04213  Longevity regulating pathway - multiple species
bta04261  Adrenergic signaling in cardiomyocytes
bta04270  Vascular smooth muscle contraction
bta04310  Wnt signaling pathway
bta04340  Hedgehog signaling pathway
bta04371  Apelin signaling pathway
bta04530  Tight junction
bta04540  Gap junction
bta04611  Platelet activation
bta04713  Circadian entrainment
bta04714  Thermogenesis
bta04720  Long-term potentiation
bta04723  Retrograde endocannabinoid signaling
bta04724  Glutamatergic synapse
bta04725  Cholinergic synapse
bta04726  Serotonergic synapse
bta04727  GABAergic synapse
bta04728  Dopaminergic synapse
bta04740  Olfactory transduction
bta04742  Taste transduction
bta04750  Inflammatory mediator regulation of TRP channels
bta04910  Insulin signaling pathway
bta04911  Insulin secretion
bta04912  GnRH signaling pathway
bta04913  Ovarian steroidogenesis
bta04914  Progesterone-mediated oocyte maturation
bta04915  Estrogen signaling pathway
bta04916  Melanogenesis
bta04918  Thyroid hormone synthesis
bta04919  Thyroid hormone signaling pathway
bta04921  Oxytocin signaling pathway
bta04922  Glucagon signaling pathway
bta04923  Regulation of lipolysis in adipocytes
bta04924  Renin secretion
bta04925  Aldosterone synthesis and secretion
bta04926  Relaxin signaling pathway
bta04927  Cortisol synthesis and secretion
bta04928  Parathyroid hormone synthesis, secretion and action
bta04934  Cushing's syndrome
bta04961  Endocrine and other factor-regulated calcium reabsorption
bta04962  Vasopressin-regulated water reabsorption
bta04970  Salivary secretion
bta04971  Gastric acid secretion
bta04976  Bile secretion
bta05012  Parkinson's disease
bta05020  Prion diseases
bta05030  Cocaine addiction
bta05031  Amphetamine addiction
bta05032  Morphine addiction
bta05146  Amoebiasis
bta05165  Human papillomavirus infection
bta05166  HTLV-I infection
bta05169  Epstein-Barr virus infection
bta05200  Pathways in cancer
bta05203  Viral carcinogenesis
bta05205  Proteoglycans in cancer
bta05414  Dilated cardiomyopathy (DCM)
Module
bta_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    282323 (PRKACB)
   04010 MAPK signaling pathway
    282323 (PRKACB)
   04310 Wnt signaling pathway
    282323 (PRKACB)
   04340 Hedgehog signaling pathway
    282323 (PRKACB)
   04371 Apelin signaling pathway
    282323 (PRKACB)
   04020 Calcium signaling pathway
    282323 (PRKACB)
   04024 cAMP signaling pathway
    282323 (PRKACB)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    282323 (PRKACB)
  Cell growth and death
   04114 Oocyte meiosis
    282323 (PRKACB)
  Cellular community - eukaryotes
   04530 Tight junction
    282323 (PRKACB)
   04540 Gap junction
    282323 (PRKACB)
 Organismal Systems
  Immune system
   04611 Platelet activation
    282323 (PRKACB)
   04062 Chemokine signaling pathway
    282323 (PRKACB)
  Endocrine system
   04911 Insulin secretion
    282323 (PRKACB)
   04910 Insulin signaling pathway
    282323 (PRKACB)
   04922 Glucagon signaling pathway
    282323 (PRKACB)
   04923 Regulation of lipolysis in adipocyte
    282323 (PRKACB)
   04912 GnRH signaling pathway
    282323 (PRKACB)
   04913 Ovarian Steroidogenesis
    282323 (PRKACB)
   04915 Estrogen signaling pathway
    282323 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    282323 (PRKACB)
   04921 Oxytocin signaling pathway
    282323 (PRKACB)
   04926 Relaxin signaling pathway
    282323 (PRKACB)
   04918 Thyroid hormone synthesis
    282323 (PRKACB)
   04919 Thyroid hormone signaling pathway
    282323 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    282323 (PRKACB)
   04916 Melanogenesis
    282323 (PRKACB)
   04924 Renin secretion
    282323 (PRKACB)
   04925 Aldosterone synthesis and secretion
    282323 (PRKACB)
   04927 Cortisol synthesis and secretion
    282323 (PRKACB)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    282323 (PRKACB)
   04270 Vascular smooth muscle contraction
    282323 (PRKACB)
  Digestive system
   04970 Salivary secretion
    282323 (PRKACB)
   04971 Gastric acid secretion
    282323 (PRKACB)
   04976 Bile secretion
    282323 (PRKACB)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    282323 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    282323 (PRKACB)
  Nervous system
   04724 Glutamatergic synapse
    282323 (PRKACB)
   04727 GABAergic synapse
    282323 (PRKACB)
   04725 Cholinergic synapse
    282323 (PRKACB)
   04728 Dopaminergic synapse
    282323 (PRKACB)
   04726 Serotonergic synapse
    282323 (PRKACB)
   04720 Long-term potentiation
    282323 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    282323 (PRKACB)
  Sensory system
   04740 Olfactory transduction
    282323 (PRKACB)
   04742 Taste transduction
    282323 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    282323 (PRKACB)
  Aging
   04211 Longevity regulating pathway - mammal
    282323 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    282323 (PRKACB)
  Environmental adaptation
   04713 Circadian entrainment
    282323 (PRKACB)
   04714 Thermogenesis
    282323 (PRKACB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    282323 (PRKACB)
   05205 Proteoglycans in cancer
    282323 (PRKACB)
   05203 Viral carcinogenesis
    282323 (PRKACB)
  Neurodegenerative diseases
   05012 Parkinson's disease
    282323 (PRKACB)
   05020 Prion diseases
    282323 (PRKACB)
  Substance dependence
   05030 Cocaine addiction
    282323 (PRKACB)
   05031 Amphetamine addiction
    282323 (PRKACB)
   05032 Morphine addiction
    282323 (PRKACB)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    282323 (PRKACB)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    282323 (PRKACB)
  Infectious diseases
   05166 HTLV-I infection
    282323 (PRKACB)
   05169 Epstein-Barr virus infection
    282323 (PRKACB)
   05165 Human papillomavirus infection
    282323 (PRKACB)
   05146 Amoebiasis
    282323 (PRKACB)
  Drug resistance
   01522 Endocrine resistance
    282323 (PRKACB)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     282323 (PRKACB)
Protein kinases [BR:bta01001]
 Serine/threonine kinases: AGC group
  PKA family
   282323 (PRKACB)
Messenger RNA biogenesis [BR:bta03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     282323 (PRKACB)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    282323 (PRKACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 282323
NCBI-ProteinID: NP_777010
Ensembl: ENSBTAG00000011953
VGNC: 33321
UniProt: P05131
Position
3
AA seq 351 aa AA seqDB search
MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPAPNNAGLEDFERKKTLGTGSFGRVML
VKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFAT
TDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCGKEFCEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggggaacgcggcgaccgccaagaaaggcagcgaggtggagagcgtgaaagagtttcta
gccaaagccaaagaagactttttaaaaaaatgggaaaatcctgctccgaataatgctggg
ctggaggattttgaaaggaaaaaaacccttggaacaggttcatttggaagagtcatgttg
gtgaaacacaaagccactgaacagtattatgccatgaagatcttagataagcagaaggtt
gttaaactgaagcaaatagagcatactttgaatgagaaaagaatattacaggcagtgaat
tttccttttcttgttcgactggaatatgcttttaaggataattctaatttatacatggtt
atggaatatgttcctggtggtgaaatgttttcacatctaagaagaattggaaggttcagt
gaaccccatgcacggttctatgcagctcagatagtgctaacattcgagtacctccattca
ctagacctcatctacagagatctaaaacctgaaaatctcttaattgaccaccaaggttat
atccaggtcacagactttgggtttgccaaaagagttaaaggcagaacttggacattatgt
ggcactccagaatatttggctccagaaatcattctcagcaagggctacaataaggcagtg
gattggtgggcgttaggagtgttaatctatgaaatggcggctggctaccccccattcttt
gcagaccaaccaattcagatttatgaaaaaattgtttctggaaaggttcgattcccttct
cacttcagttcagatctcaaggaccttctaaggaacctgctgcaggtagacttaacaaag
cggtttggaaatctaaagaatggtgtgagtgacataaaaactcacaagtggtttgccaca
acagactggattgctatttaccagagaaaggttgaagctccattcataccaaagttcaga
ggctctggagataccagcaactttgatgactatgaagaagaagatatccgtgtctctata
acagaaaaatgtgggaaagaattttgtgaattttag

DBGET integrated database retrieval system