KEGG   Bos taurus (cow): 282363Help
Entry
282363            CDS       T01008                                 

Gene name
SLC6A2
Definition
(RefSeq) sodium-dependent noradrenaline transporter
  KO
K05035  solute carrier family 6 (neurotransmitter transporter, noradrenalin) member 2
Organism
bta  Bos taurus (cow)
Pathway
bta04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    282363 (SLC6A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bta02000]
    282363 (SLC6A2)
Transporters [BR:bta02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   282363 (SLC6A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF
Motif
Other DBs
NCBI-GeneID: 282363
NCBI-ProteinID: NP_777033
Ensembl: ENSBTAG00000003353
VGNC: 34920
UniProt: P51143
Position
18
AA seq 615 aa AA seqDB search
MLLARMNPQVQPENGGAGPGSEQPPRKRKEVLVVKERNGVQCLLASRDGDEQPRETWGKK
IDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLFYMELALGQYNRE
GAATVWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFSSFTPTLPWTDCGHAWNS
PNCTDPKLLNSSVLGNHTKYSKYKFTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLCLI
IVVIVLFFSLWKGVKTSGKVVWITATLPYLVLFVLLVHGITLPGASNGINAYLHIDFYRL
KEATVWIDAATQIFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSTINCVTSFISGFAIF
SILGYMAHEHKVNIEDVATEGAGLVFILYPEAISTLSGSTFWAIVFFIMLLALGIDSSMG
GMEAVITGLADDFQVLKRHRKLFTFAVSFGTFLLALFCITKGGIYVLTLLDTFAAGTSIL
FAVLMEAIGVSWFYGVDRFSNDIQQMMGFKPGLYWRLCWKFVSPAFLLFVVIVSIINFKP
LTYDDYIFPLWANWVGWGIAGSSMVLVPAYIVYKFFSTRGSIRERLAYGITPASEHHLVA
QRDIRQFQLQHWLAI
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgcttctggcgcggatgaacccgcaggtgcagccggagaacggcggggcgggcccgggg
tcggagcagcccccgcggaagcgcaaagaagtcttggtggtgaaagagcgcaacggcgtc
cagtgcctcctggcgtcccgcgacggcgatgagcagccccgagagacctggggcaagaag
atcgacttcctgctgtcggtggtcggcttcgctgtagacctggccaacgtgtggcgcttc
ccctatctctgctacaagaacggaggcggtgccttcctgatcccgtacaccctgttcctc
atcatcgctgggatgcccctcttctacatggagctggctctgggccagtacaaccgggaa
ggggcagccaccgtgtggaagatctgcccatttttcaaaggagttggctacgctgtgatc
ctcatcgccctctacgttggcttctactacaacgtcattatcgcctggtccctctactac
ctcttctcttccttcaccccgaccctgccctggaccgactgtggccacgcctggaacagc
cccaactgcacagaccccaagctcctcaacagctccgtgctgggcaaccacaccaagtac
tccaagtacaagttcacacctgcagcagagttttacgagcgtggtgtcctgcatctgcat
gagagcagtgggattcatgacattggcctgccccagtggcagcttttgctctgtctgatc
atcgttgtcatcgtcctgttttttagcctctggaaaggagtgaagacatcaggaaaggtc
gtgtggatcacggccacgctgccttacctcgtgctgttcgtgctcctggtccatggcatc
acgctgcccggcgcctccaacggcatcaacgcctacctgcacatcgacttctaccgccta
aaagaggccacggtgtggattgatgctgcaactcagatattcttttccttgggggctgga
tttggagtcttgattgcatttgctagttacaacaaatttgacaataactgctacagggat
gccctgctgaccagcaccatcaactgtgtcaccagcttcatctccgggttcgccatcttc
tccatccttggttacatggcccatgaacacaaggtcaacattgaggatgttgccactgaa
ggagctggcctagtcttcatcctgtacccagaagccatttctaccctctcgggatccaca
ttctgggccattgtgttcttcatcatgctcctggctctgggaattgacagctcgatggga
ggcatggaggcggtcatcacgggcctggctgatgacttccaggttctgaagcgacaccgg
aaactcttcacgtttgctgtctcctttggaaccttccttctggctctgttttgtataacc
aagggtggaatatatgtgctgaccctgttggacacgtttgcggcggggacctccattctt
tttgctgtgctcatggaagccatcggcgtctcctggttttatggagtggacaggttcagc
aacgacatccagcagatgatggggttcaagcccggcctgtactggagactctgctggaag
tttgtcagccctgccttcctcctgtttgtggtgattgtgagtatcatcaatttcaagcca
ctcacttacgatgactacatcttcccactctgggccaactgggtcggatggggcatcgcg
ggctcctccatggttctggtgcccgcctacatcgtctacaagttcttcagcacccggggc
tccattcgagagagactggcctatggcataactccagcgagcgagcatcacctggtggcc
cagagggacatcaggcagttccaattgcaacactggctggccatctga

DBGET integrated database retrieval system