KEGG   Bos taurus (cow): 282384
Entry
282384            CDS       T01008                                 

Gene name
TM7SF2
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
bta  Bos taurus (cow)
Pathway
bta00100  Steroid biosynthesis
bta01100  Metabolic pathways
Module
bta_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    282384 (TM7SF2)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     282384 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 282384
NCBI-ProteinID: NP_777047
BGD-bta: BT30421
Ensembl: ENSBTAG00000005069
VGNC: 35910
UniProt: Q17QS8
Position
29
AA seq 418 aa
MAPPQGSRAPLEFGGPLGAAALMLLLPVTMFHLLLVARSGPARLLGPPPYLPGLEELWSP
WALLLCLTWLGLQAALYLLPARKVAEGQELKDKSRLRYPINGFQALVLTALLVGLGVSAG
LPLSALPEMLLPLAFAATLTAFIFSLLLYLKALLAPASALAPGGNSGNLIYDFFLGRELN
PRICSFDFKYFCELRPGLIGWVLINLALLIQEAELRGSPSLAMWLVNGFQLLYVGDALWY
EEAVLTTMDIIHDGFGFMLAFGDLAWVPFTYSLQAQFLLYHPQPLGWPLASFICLINAVG
YYIFRGANSQKNTFRKNPSDPRVADLETISTATGRRLLVSGWWGMVRHPNYLGDLIMALA
WSLPCGVFHLLPYFYFLYFTALLVHREDRDERQCRQKYGLAWHEYCRRVPYRIVPYIY
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcccctcctcagggctctcgggccccgctggaattcggaggacccttgggcgccgcg
gcgctgatgctgctgctcccggtcactatgttccacctgctactggtggcccgctcgggc
ccggcgcgcctcctgggcccacccccctacctgccgggactggaggagctgtggagcccg
tgggcgctgttgctctgtctcacctggctcggcctgcaggcggcgctctacctcttgccg
gcgcgtaaggtggctgaggggcaggaattgaaggacaagagtcgactgcgctaccccatt
aacggcttccaggccctggtgctgacagccctcttggtgggcctgggggtgtcagccggg
ctgcccctgagcgcgctcccggaaatgctcttgcccttggcgtttgcggccaccctcacc
gccttcatcttcagcctccttctgtatctgaaggctctgctagcccctgcctcggccctg
gcacctggagggaactcaggcaatctcatttacgactttttcctgggacgggagctcaac
ccgcgcatctgttcctttgacttcaaatatttctgcgaactgcggcctggcctcatcggc
tgggtcctcatcaacctggcgttgctgatacaggaagcagaacttcgggggagtccctcg
ctggccatgtggctggtcaatggcttccagctactgtacgtgggtgatgccctttggtac
gaggaggcagtcctgaccaccatggacatcatccatgacgggtttggcttcatgctggcc
tttggggacctcgcctgggtacccttcacctacagcctgcaggcccagttcctgctgtat
cacccacagcctctggggtggcccctggcctcattcatctgcctcatcaatgctgttggt
tactacatctttcgtggagccaattctcagaaaaacaccttccgaaagaatccttctgat
cccagagtggctgaccttgagaccatctctacagccacagggcgacggctgctggtgtcc
gggtggtggggtatggtccgccatcccaactaccttggagacctcatcatggctctggcc
tggtccttgccgtgtggggtgttccacctgctgccctacttctacttcctctacttcacc
gcgctgctggtgcaccgtgaggaccgggatgagaggcagtgtcggcagaagtacggcctg
gcctggcacgagtactgccggcgtgtgccctaccgaatcgtgccctacatctactga

DBGET integrated database retrieval system