KEGG   Bos taurus (cow): 282477
Entry
282477            CDS       T01008                                 

Gene name
SLC25A3
Definition
(RefSeq) phosphate carrier protein, mitochondrial precursor
  KO
K15102  solute carrier family 25 (mitochondrial phosphate transporter), member 3
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bta02000]
    282477 (SLC25A3)
   04147 Exosome [BR:bta04147]
    282477 (SLC25A3)
Transporters [BR:bta02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   282477 (SLC25A3)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   282477 (SLC25A3)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 282477
NCBI-ProteinID: NP_777082
Ensembl: ENSBTAG00000012890
VGNC: 49861
UniProt: P12234
Position
5
AA seq 362 aa
MYSSVVHLARANPFNAPHLQLVHDGLAGPRSDPAGPPGPPRRSRNLAAAAVEEQYSCDYG
SGRFFILCGLGGIISCGTTHTALVPLDLVKCRMQVDPQKYKSIFNGFSVTLKEDGFRGLA
KGWAPTFIGYSLQGLCKFGFYEVFKVLYSNMLGEENAYLWRTSLYLAASASAEFFADIAL
APMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFER
TVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSAS
EVLKRLGFRGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGY
TQ
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgtactcgtccgtggtgcacctagcgcgggcgaaccccttcaacgcgcctcacctgcag
ttggtgcacgatggtctcgcggggccccgcagcgaccccgccgggcccccgggcccaccc
cgccgctctcgcaacctggcagccgccgctgtagaagagcagtatagctgtgactatgga
tctggcagattctttatcctttgtggacttggaggaattattagctgtggcacaacacat
acagcattggttcctctagatctggttaaatgcaggatgcaggtggacccacaaaagtac
aagagcatatttaatggattttcagttacactcaaagaggatggttttcgtggtttggcc
aaaggatgggctccgactttcattggctactccctgcagggactctgcaagtttggcttt
tatgaagtcttcaaagttttgtacagcaacatgcttggagaggagaatgcctatctgtgg
cgcacatcactgtatttggctgcctctgccagtgctgaattctttgctgacattgctctg
gctcctatggaagctgctaaggttcgaattcaaacccagccaggttatgctaacactctg
agggatgcagctcccaaaatgtataaggaagaaggcttaaaggcgttctacaagggggtt
gcccctctctggatgaggcagataccatacaccatgatgaagtttgcctgctttgaacgt
actgttgaagcattgtacaagtttgtggttcccaagccccgaagtgaatgttcaaagcca
gagcagctggttgtcacatttgtggcaggttacatagctggagtcttctgtgccattgtt
tctcaccctgctgattccgtggtgtctgtgttgaataaagagaagggtagcagtgcctct
gaggtcctgaagaggcttggatttagaggtgtatggaagggactctttgcccgtatcatc
atgatcggcactctgactgcactacagtggtttatctatgactctgtgaaggtctacttc
aggctccctcgccctcctccacctgagatgccagaatctctgaagaaaaagcttgggtac
actcaatag

DBGET integrated database retrieval system