KEGG   Bos taurus (cow): 282479
Entry
282479            CDS       T01008                                 

Gene name
SLC25A5
Definition
(RefSeq) ADP/ATP translocase 2
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
bta  Bos taurus (cow)
Pathway
bta04020  Calcium signaling pathway
bta04022  cGMP-PKG signaling pathway
bta04217  Necroptosis
bta04218  Cellular senescence
bta04613  Neutrophil extracellular trap formation
bta05010  Alzheimer disease
bta05012  Parkinson disease
bta05016  Huntington disease
bta05017  Spinocerebellar ataxia
bta05020  Prion disease
bta05022  Pathways of neurodegeneration - multiple diseases
bta05164  Influenza A
bta05166  Human T-cell leukemia virus 1 infection
bta05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    282479 (SLC25A5)
   04022 cGMP-PKG signaling pathway
    282479 (SLC25A5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    282479 (SLC25A5)
   04218 Cellular senescence
    282479 (SLC25A5)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    282479 (SLC25A5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    282479 (SLC25A5)
   05164 Influenza A
    282479 (SLC25A5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    282479 (SLC25A5)
   05012 Parkinson disease
    282479 (SLC25A5)
   05016 Huntington disease
    282479 (SLC25A5)
   05017 Spinocerebellar ataxia
    282479 (SLC25A5)
   05020 Prion disease
    282479 (SLC25A5)
   05022 Pathways of neurodegeneration - multiple diseases
    282479 (SLC25A5)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    282479 (SLC25A5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bta03029]
    282479 (SLC25A5)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bta02000]
    282479 (SLC25A5)
Mitochondrial biogenesis [BR:bta03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    282479 (SLC25A5)
Transporters [BR:bta02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   282479 (SLC25A5)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 282479
NCBI-ProteinID: NP_777084
Ensembl: ENSBTAG00000046037
VGNC: 49862
UniProt: Q8SQH5
Position
X
AA seq 298 aa
MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIRGLYQGFNVS
VQGIIIYRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMM
QSGRKGTDIMYTGTLDCWRKIARDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKFT
NT seq 897 nt   +upstreamnt  +downstreamnt
atgacagatgccgccgtgtccttcgccaaggacttcctggcaggtggagtggcagcggcc
atctccaagaccgcagtcgcgcccatcgagcgggtgaagctgctgctgcaggtgcagcat
gccagcaagcaaatcactgcagataagcagtacaagggcatcatagactgcgtggttcgt
atccccaaggagcagggagtcctgtccttctggcgtggtaacctggccaatgtgatcaga
tacttccccacccaggctctcaactttgccttcaaagataaatacaagcagatcttcctg
ggtggtgtggacaagaggacccagttttggcgctactttgcagggaatctggcatcaggt
ggtgccgccggggccacttccctgtgtttcgtgtaccctctcgactttgcccgtacccgt
ctagcagccgacgtgggcaaagctggagctgaaagggaattcagaggcctcggtgactgt
ctggttaagatctacaaatctgacgggattagaggcctgtaccaaggctttaacgtgtct
gtgcagggtattatcatctaccgagctgcctacttcggtatctatgacactgccaaggga
atgcttccagatcccaagaacactcatatcttcatcagctggatgatcgcacaatcagtc
acggcagttgctgggttgacttcctatccatttgacactgtgcgtcgccgcatgatgatg
cagtcagggcgcaaaggaactgatatcatgtacacaggcacgcttgactgctggaggaag
attgctcgtgacgaaggagccaaagcctttttcaaaggcgcgtggtccaatgttctcaga
ggcatgggcggggcgtttgtgcttgtcctgtatgatgaaatcaagaagttcacctaa

DBGET integrated database retrieval system