KEGG   Bos taurus (cow): 282514
Entry
282514            CDS       T01008                                 

Gene name
PAFAH1B2
Definition
(RefSeq) platelet-activating factor acetylhydrolase IB subunit beta
  KO
K16795  platelet-activating factor acetylhydrolase IB subunit beta/gamma [EC:3.1.1.47]
Organism
bta  Bos taurus (cow)
Pathway
bta00565  Ether lipid metabolism
bta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    282514 (PAFAH1B2)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     282514 (PAFAH1B2)
SSDB
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL
Other DBs
NCBI-GeneID: 282514
NCBI-ProteinID: NP_777089
BGD-bta: BT29005
Ensembl: ENSBTAG00000005627
VGNC: 32550
UniProt: P68401 V6F7P3
Structure
PDB: 
1FXW

Position
15
AA seq 229 aa
MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWR
ELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEA
IVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFV
HSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA
NT seq 690 nt   +upstreamnt  +downstreamnt
atgagccaaggagactcaaacccagcagccattccacatgcagcagaagatattcaagga
gacgacagatggatgtctcagcacaacagatttgtcctggactgcaaagacaaagagccg
gatgtcctgttcgtgggggactccatggtacagttgatgcagcagtatgagatatggcga
gagcttttttctccacttcatgcactgaattttggaattgggggagatacaacaagacat
gttttatggagactaaagaatggagaactggagaatattaaacctaaggtcatcgttgtc
tgggtaggaacaaacaaccatgaaaatacagcagaggaagtagcaggtggaatcgaggcc
atcgtacagcttatcaacacaaggcagccacaggccaaaatcattgtattgggtttgtta
cctcgaggtgagaagcccaaccccttgaggcaaaagaatgccaaggtgaaccagctcctc
aaggtctccctgccgaagctcgccaacgttcagctcctggacacagacgggggcttcgtg
cactcggacggtgccatctcctgccacgacatgtttgattttctgcatctcacaggaggt
ggctatgcaaagatctgcaaacccctccatgaactgatcatgcagttgttggaggaaaca
cctgaggaaaaacaaaccaccattgcctga

DBGET integrated database retrieval system