KEGG   Bos taurus (cow): 282523
Entry
282523            CDS       T01008                                 

Gene name
SLC25A11
Definition
(RefSeq) mitochondrial 2-oxoglutarate/malate carrier protein
  KO
K15104  solute carrier family 25 (mitochondrial oxoglutarate transporter), member 11
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bta02000]
    282523 (SLC25A11)
Transporters [BR:bta02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   282523 (SLC25A11)
SSDB
Motif
Pfam: Mito_carr VMAP-M0
Other DBs
NCBI-GeneID: 282523
NCBI-ProteinID: NP_777096
BGD-bta: BT13569
Ensembl: ENSBTAG00000004910
VGNC: 34742
UniProt: P22292
Position
19
AA seq 314 aa
MAATASPGASGMDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTRE
YKTSFHALISILRAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFL
LKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPVDQRRGYKNVFNALFRIVQEEGVPTL
WRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPV
DIVKTRIQNMRMIDGKPEYKNGLDVLVKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFL
EQMNKAYKRLFLSG
NT seq 945 nt   +upstreamnt  +downstreamnt
atggcggcgacggcgagtcccggggcttctgggatggacgggaagccccgtacctcccct
aagtccgtcaagttcctgtttgggggcctggccgggatgggagctacagtttttgtgcag
cccttggacctggtgaagaaccggatgcagctgagtggggaaggagccaagacacgagag
tacaaaaccagcttccatgccctcatcagcatcctgagggcagaagggcttaggggcatt
tacaccgggctatcagctggcctgttgcgccaggccacctacactactactcgtcttggt
atctatactgtgctgtttgagcgcctgactggggctgatggtacaccccctggctttctg
ctgaaggctgtgattggcatgactgcaggtgcaactggtgcctttgtgggaacaccagct
gaagtggctcttatccgcatgaccgctgatggccggcttccagttgaccagcgtcgtggc
tacaaaaacgtgtttaatgccctgtttcgaattgtccaggaagagggggtccccacacta
tggaggggctgcatccctaccatggctcgggctgtcgtcgtcaacgctgcccagcttgcc
tcctactcccagtccaagcagtttttactggactcaggctacttctctgacaacatcctg
tgccacttctgtgctagcatgatcagtggcctggtcaccactgctgcctccatgcccgtg
gacattgtcaagacccggatccagaacatgcggatgattgacgggaagccagaatacaag
aatgggctggatgtgctggtgaaggtcgtgcgctacgagggcttcttcagcctgtggaag
ggctttacaccatactatgcccgcctgggcccccacactgtcctcactttcatcttcttg
gagcagatgaacaaggcctacaagcgtctcttcctcagtggctga

DBGET integrated database retrieval system