KEGG   Bos taurus (cow): 282527Help
Entry
282527            CDS       T01008                                 

Gene name
TNFRSF1A
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 1A precursor
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04060  Cytokine-cytokine receptor interaction
bta04064  NF-kappa B signaling pathway
bta04071  Sphingolipid signaling pathway
bta04150  mTOR signaling pathway
bta04210  Apoptosis
bta04215  Apoptosis - multiple species
bta04217  Necroptosis
bta04380  Osteoclast differentiation
bta04668  TNF signaling pathway
bta04920  Adipocytokine signaling pathway
bta04931  Insulin resistance
bta04932  Non-alcoholic fatty liver disease (NAFLD)
bta05010  Alzheimer's disease
bta05014  Amyotrophic lateral sclerosis (ALS)
bta05142  Chagas disease (American trypanosomiasis)
bta05145  Toxoplasmosis
bta05152  Tuberculosis
bta05160  Hepatitis C
bta05164  Influenza A
bta05165  Human papillomavirus infection
bta05166  HTLV-I infection
bta05167  Kaposi's sarcoma-associated herpesvirus infection
bta05168  Herpes simplex infection
bta05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    282527 (TNFRSF1A)
   04064 NF-kappa B signaling pathway
    282527 (TNFRSF1A)
   04668 TNF signaling pathway
    282527 (TNFRSF1A)
   04071 Sphingolipid signaling pathway
    282527 (TNFRSF1A)
   04150 mTOR signaling pathway
    282527 (TNFRSF1A)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    282527 (TNFRSF1A)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    282527 (TNFRSF1A)
   04215 Apoptosis - multiple species
    282527 (TNFRSF1A)
   04217 Necroptosis
    282527 (TNFRSF1A)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    282527 (TNFRSF1A)
  Development
   04380 Osteoclast differentiation
    282527 (TNFRSF1A)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    282527 (TNFRSF1A)
   05014 Amyotrophic lateral sclerosis (ALS)
    282527 (TNFRSF1A)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    282527 (TNFRSF1A)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    282527 (TNFRSF1A)
   04931 Insulin resistance
    282527 (TNFRSF1A)
  Infectious diseases
   05152 Tuberculosis
    282527 (TNFRSF1A)
   05166 HTLV-I infection
    282527 (TNFRSF1A)
   05164 Influenza A
    282527 (TNFRSF1A)
   05160 Hepatitis C
    282527 (TNFRSF1A)
   05168 Herpes simplex infection
    282527 (TNFRSF1A)
   05163 Human cytomegalovirus infection
    282527 (TNFRSF1A)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    282527 (TNFRSF1A)
   05165 Human papillomavirus infection
    282527 (TNFRSF1A)
   05145 Toxoplasmosis
    282527 (TNFRSF1A)
   05142 Chagas disease (American trypanosomiasis)
    282527 (TNFRSF1A)
Cytokine receptors [BR:bta04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   282527 (TNFRSF1A)
CD molecules [BR:bta04090]
 Proteins
  282527 (TNFRSF1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Death TNFR_c6
Motif
Other DBs
NCBI-GeneID: 282527
NCBI-ProteinID: NP_777099
BGD-bta: BT10161
Ensembl: ENSBTAG00000004211
VGNC: 36164
UniProt: O19131
Position
5
AA seq 471 aa AA seqDB search
MGLPTVPGLLLPLVLPALLADVYPAGVQGLVPHPGDLEKRESPCPQGKYNHPQNSTICCT
KCHKGTYLYNDCPGPGRDTDCRVCAPGTYTALENHLRRCLSCSRCRDEMFQVEISPCVVD
RDTVCGCRKNQYREYWGETGFRCLNCSLCPNGTVNIPCQERQDTICHCHMGFFLKGAKCI
SCHDCKNKECEKLCPTRPSTGKDSQDPGTTVLLPLVIVFGLCLASFASVVLACRYQRWKP
KLYSIICGQSTLVKEGEPELLVPAPGFNPTTTICFSSTPSSSPVSIPPYISCDRSNFGAV
ASPSSETAPPHLKAGPILPGPPASTHLCTPGPPASTHLCTPGPPASTHLCTPVQKWEASA
PSAPDQLADADPATLYAVVDGVPPSRWKELVRRLGLSEHEIERLELENGRHLREAQYSML
AAWRRRTPRREATLELLGRVLRDMDLLGCLENIEEALGGAARLASEPRLLW
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgggcctccccaccgtgcctggcctgctgctgccactggtgcttccagctctgttggca
gatgtgtaccccgcaggggttcaggggctggtccctcaccccggggacctggagaagaga
gagagtccctgtccccaaggaaaatataaccacccgcaaaatagcaccatttgctgcacc
aagtgccacaaaggtacctatctgtacaatgactgtccgggtccagggcgagacacggac
tgcagggtgtgtgcccctggcacctacactgccttggagaaccatctcagacgatgcctg
agctgctccaggtgccgggacgaaatgttccaggtggagatttcgccttgtgtagtggac
cgggacactgtgtgcggctgcaggaagaaccagtaccgggaatactggggtgaaactggc
ttccggtgtctgaactgcagcctctgtcccaatggcacagtgaatatcccctgccaggag
agacaggacaccatctgccactgccatatgggcttctttcttaaaggcgccaagtgcatc
tcctgtcatgattgtaagaacaaggagtgcgagaagttatgtccaacccgaccttcaact
ggtaaagactctcaggacccaggcactacagtactattacccctggtgattgtcttcggg
ctttgcctggcatccttcgcctctgtcgtcttagcatgtcgctaccagcggtggaagccc
aagctctactccatcatttgcgggcagtcgactctggtaaaagagggggagccagaactc
ctggtcccggccccaggcttcaaccccaccaccaccatctgcttcagctccaccccaagt
tccagtcctgtctccattcccccttacatctcctgtgaccggtccaacttcggagccgtc
gcatctccctccagcgagacggccccgccccatctaaaggctggccccatcctcccgggg
cctccggcctccacccacctctgtaccccggggcctccggcctccacccacctctgtacc
ccggggcctccggcctccacccacctctgcaccccagttcagaagtgggaagccagcgcc
cccagcgcccccgatcagctcgcggatgccgaccccgcgaccctgtacgcggtggtggac
ggcgtgcccccgtcgcgctggaaggagttggtgcggcggctgggactgagcgagcacgag
atcgagcggctggagctggagaacgggcgccacctgcgcgaggcgcagtacagcatgctg
gcggcctggcggcggcgcacgccgcgccgcgaggccacgctggagctgctgggccgcgtg
ctcagggacatggacctgctgggttgcctggaaaacatagaggaggcgctgggtggcgcc
gcccgcctcgcgtccgagccccgccttctctggtga

DBGET integrated database retrieval system