KEGG   Bos taurus (cow): 282527Help
Entry
282527            CDS       T01008                                 

Gene name
TNFRSF1A
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 1A precursor
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04060  Cytokine-cytokine receptor interaction
bta04064  NF-kappa B signaling pathway
bta04071  Sphingolipid signaling pathway
bta04150  mTOR signaling pathway
bta04210  Apoptosis
bta04215  Apoptosis - multiple species
bta04217  Necroptosis
bta04380  Osteoclast differentiation
bta04668  TNF signaling pathway
bta04920  Adipocytokine signaling pathway
bta04931  Insulin resistance
bta04932  Non-alcoholic fatty liver disease (NAFLD)
bta05010  Alzheimer disease
bta05014  Amyotrophic lateral sclerosis (ALS)
bta05142  Chagas disease (American trypanosomiasis)
bta05145  Toxoplasmosis
bta05152  Tuberculosis
bta05160  Hepatitis C
bta05163  Human cytomegalovirus infection
bta05164  Influenza A
bta05165  Human papillomavirus infection
bta05166  Human T-cell leukemia virus 1 infection
bta05167  Kaposi sarcoma-associated herpesvirus infection
bta05168  Herpes simplex infection
bta05170  Human immunodeficiency virus 1 infection
bta05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    282527 (TNFRSF1A)
   04064 NF-kappa B signaling pathway
    282527 (TNFRSF1A)
   04668 TNF signaling pathway
    282527 (TNFRSF1A)
   04071 Sphingolipid signaling pathway
    282527 (TNFRSF1A)
   04150 mTOR signaling pathway
    282527 (TNFRSF1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    282527 (TNFRSF1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    282527 (TNFRSF1A)
   04215 Apoptosis - multiple species
    282527 (TNFRSF1A)
   04217 Necroptosis
    282527 (TNFRSF1A)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    282527 (TNFRSF1A)
  09158 Development
   04380 Osteoclast differentiation
    282527 (TNFRSF1A)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    282527 (TNFRSF1A)
   05014 Amyotrophic lateral sclerosis (ALS)
    282527 (TNFRSF1A)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    282527 (TNFRSF1A)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    282527 (TNFRSF1A)
   04931 Insulin resistance
    282527 (TNFRSF1A)
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    282527 (TNFRSF1A)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    282527 (TNFRSF1A)
   05170 Human immunodeficiency virus 1 infection
    282527 (TNFRSF1A)
   05164 Influenza A
    282527 (TNFRSF1A)
   05160 Hepatitis C
    282527 (TNFRSF1A)
   05168 Herpes simplex infection
    282527 (TNFRSF1A)
   05163 Human cytomegalovirus infection
    282527 (TNFRSF1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    282527 (TNFRSF1A)
   05165 Human papillomavirus infection
    282527 (TNFRSF1A)
  09174 Infectious diseases: Parasitic
   05145 Toxoplasmosis
    282527 (TNFRSF1A)
   05142 Chagas disease (American trypanosomiasis)
    282527 (TNFRSF1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bta04050]
    282527 (TNFRSF1A)
   04090 CD molecules [BR:bta04090]
    282527 (TNFRSF1A)
Cytokine receptors [BR:bta04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   282527 (TNFRSF1A)
CD molecules [BR:bta04090]
 Proteins
  282527 (TNFRSF1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Death TNFR_c6
Motif
Other DBs
NCBI-GeneID: 282527
NCBI-ProteinID: NP_777099
BGD-bta: BT10161
Ensembl: ENSBTAG00000004211
VGNC: 36164
UniProt: O19131
Position
5
AA seq 471 aa AA seqDB search
MGLPTVPGLLLPLVLPALLADVYPAGVQGLVPHPGDLEKRESPCPQGKYNHPQNSTICCT
KCHKGTYLYNDCPGPGRDTDCRVCAPGTYTALENHLRRCLSCSRCRDEMFQVEISPCVVD
RDTVCGCRKNQYREYWGETGFRCLNCSLCPNGTVNIPCQERQDTICHCHMGFFLKGAKCI
SCHDCKNKECEKLCPTRPSTGKDSQDPGTTVLLPLVIVFGLCLASFASVVLACRYQRWKP
KLYSIICGQSTLVKEGEPELLVPAPGFNPTTTICFSSTPSSSPVSIPPYISCDRSNFGAV
ASPSSETAPPHLKAGPILPGPPASTHLCTPGPPASTHLCTPGPPASTHLCTPVQKWEASA
PSAPDQLADADPATLYAVVDGVPPSRWKELVRRLGLSEHEIERLELENGRHLREAQYSML
AAWRRRTPRREATLELLGRVLRDMDLLGCLENIEEALGGAARLASEPRLLW
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgggcctccccaccgtgcctggcctgctgctgccactggtgcttccagctctgttggca
gatgtgtaccccgcaggggttcaggggctggtccctcaccccggggacctggagaagaga
gagagtccctgtccccaaggaaaatataaccacccgcaaaatagcaccatttgctgcacc
aagtgccacaaaggtacctatctgtacaatgactgtccgggtccagggcgagacacggac
tgcagggtgtgtgcccctggcacctacactgccttggagaaccatctcagacgatgcctg
agctgctccaggtgccgggacgaaatgttccaggtggagatttcgccttgtgtagtggac
cgggacactgtgtgcggctgcaggaagaaccagtaccgggaatactggggtgaaactggc
ttccggtgtctgaactgcagcctctgtcccaatggcacagtgaatatcccctgccaggag
agacaggacaccatctgccactgccatatgggcttctttcttaaaggcgccaagtgcatc
tcctgtcatgattgtaagaacaaggagtgcgagaagttatgtccaacccgaccttcaact
ggtaaagactctcaggacccaggcactacagtactattacccctggtgattgtcttcggg
ctttgcctggcatccttcgcctctgtcgtcttagcatgtcgctaccagcggtggaagccc
aagctctactccatcatttgcgggcagtcgactctggtaaaagagggggagccagaactc
ctggtcccggccccaggcttcaaccccaccaccaccatctgcttcagctccaccccaagt
tccagtcctgtctccattcccccttacatctcctgtgaccggtccaacttcggagccgtc
gcatctccctccagcgagacggccccgccccatctaaaggctggccccatcctcccgggg
cctccggcctccacccacctctgtaccccggggcctccggcctccacccacctctgtacc
ccggggcctccggcctccacccacctctgcaccccagttcagaagtgggaagccagcgcc
cccagcgcccccgatcagctcgcggatgccgaccccgcgaccctgtacgcggtggtggac
ggcgtgcccccgtcgcgctggaaggagttggtgcggcggctgggactgagcgagcacgag
atcgagcggctggagctggagaacgggcgccacctgcgcgaggcgcagtacagcatgctg
gcggcctggcggcggcgcacgccgcgccgcgaggccacgctggagctgctgggccgcgtg
ctcagggacatggacctgctgggttgcctggaaaacatagaggaggcgctgggtggcgcc
gcccgcctcgcgtccgagccccgccttctctggtga

DBGET integrated database retrieval system