KEGG   Bos taurus (cow): 282682Help
Entry
282682            CDS       T01008                                 

Gene name
GRK2
Definition
(RefSeq) beta-adrenergic receptor kinase 1
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
bta  Bos taurus (cow)
Pathway
bta04062  Chemokine signaling pathway
bta04144  Endocytosis
bta04340  Hedgehog signaling pathway
bta04724  Glutamatergic synapse
bta04740  Olfactory transduction
bta05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    282682 (GRK2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    282682 (GRK2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    282682 (GRK2)
  09156 Nervous system
   04724 Glutamatergic synapse
    282682 (GRK2)
  09157 Sensory system
   04740 Olfactory transduction
    282682 (GRK2)
 09160 Human Diseases
  09164 Substance dependence
   05032 Morphine addiction
    282682 (GRK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bta01001]
    282682 (GRK2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    282682 (GRK2)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     282682 (GRK2)
Protein kinases [BR:bta01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   282682 (GRK2)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   282682 (GRK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RGS PH Kinase-like ATG16
Motif
Other DBs
NCBI-GeneID: 282682
NCBI-ProteinID: NP_777135
Ensembl: ENSBTAG00000005832
UniProt: P21146
Structure
PDB: 

Position
29
AA seq 689 aa AA seqDB search
MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFS
QKLGYLLFRDFCLKHLEEAKPLVEFYEEIKKYEKLETEEERLVCSREIFDTYIMKELLAC
SHPFSKSAIEHVQGHLVKKQVPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE
LRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARK
KTKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSL
LTMEEIQSVEETQIKERKCLLLKIRGGKQFVLQCDSDPELVQWKKELRDAYREAQQLVQR
VPKMKNKPRSPVVELSKVPLIQRGSANGL
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggcggacctggaggcggtgctggccgacgtgagctacctgatggccatggagaagagc
aaggccacgccggcggcgcgcgccagcaagaagatcctgctgcccgagcccagcatccgc
agcgtcatgcagaagtacctggaggaccggggcgaggtgacttttgagaagatcttctcc
cagaagctggggtacctgcttttccgagacttctgcctgaagcacctggaggaggccaag
cccttggtagagttctacgaggagatcaagaaatacgagaagctggagacagaggaggag
cgcctggtctgcagccgagagatcttcgacacgtacatcatgaaggagctgctggcctgc
tcacatcctttctcgaagagcgccattgagcacgtccagggccatctggtgaagaagcag
gtgcctccggatctcttccagccatatattgaagaaatttgccagaacctccgaggagac
gtgttccagaaattcatcgagagcgataaattcacacgattttgccagtggaagaatgta
gagctcaacatccacctgaccatgaacgacttcagtgtgcaccgcatcatcgggcgaggc
ggcttcggtgaggtctacggctgccggaaggccgacacgggcaagatgtacgccatgaag
tgtctggacaagaagcgcatcaagatgaagcaaggggagactctggccctgaatgagcgc
atcatgctgtcgctcgtcagcaccggggactgcccgttcatcgtctgcatgtcatacgcc
ttccacacaccggacaagctcagcttcatcctggatctcatgaacggcggggacctgcac
taccacctgtcccagcacggggtcttctccgaggccgacatgcgtttctacgccgccgag
atcatcctgggcctggagcacatgcacaaccgcttcgtggtctaccgggacctgaagccg
gccaacatcctgctggacgagcacggccacgtgcgcatctcagacctgggcctggcctgt
gacttctccaagaagaagcctcacgccagtgtgggcacccacgggtacatggctcccgag
gttctacagaagggtgtggcctacgacagcagcgccgactggttctccctgggctgcatg
ctcttcaagctgctgcgagggcatagccctttccggcagcacaagaccaaagacaagcat
gagatcgacagaatgacattgacaatggctgtggagctgcctgactccttctcccctgag
ctccgctccttgctggaggggctgctgcagagggatgtcaaccggaggctaggctgcctg
ggccgaggggcccaggaggtgaaggagagccccttcttccgttccctggactggcagatg
gtctttttacaaaagtaccctcccccgttgatccccccacgaggggaggtgaatgcagcc
gacgcctttgacattggctccttcgatgaggaggacacaaaaggaatcaagctactggac
agtgaccaggagctctaccgcaacttccccctgaccatctcggagcggtggcagcaggag
gtagcagagactgtctttgacaccatcaatgctgagacggaccggctggaggcccgcaag
aaaaccaaaaacaagcagttgggccacgaggaagactacgccctgggcaaggactgcatc
atgcatggctacatgtccaagatgggcaaccccttcctgacccagtggcagcggcggtac
ttctacctgttccctaaccggctcgagtggcggggcgagggcgaggccccgcagagcctg
ctgaccatggaggagatccagtcggtggaggagacgcagatcaaggagcgaaagtgcctc
ctcctcaagatccgaggtggcaagcagtttgtcctgcagtgcgatagtgacccagagctg
gtgcagtggaagaaggagcttcgagacgcctaccgcgaggcccagcagctagtgcagcgg
gtgcccaagatgaagaacaagccgcgctcgcccgtcgtggagctgagcaaggtgccactg
atccagcgcggcagtgccaacggcctctga

DBGET integrated database retrieval system