KEGG   Bos taurus (cow): 282702Help
Entry
282702            CDS       T01008                                 

Gene name
CHRNA3
Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-3 precursor
  KO
K04805  nicotinic acetylcholine receptor alpha-3
Organism
bta  Bos taurus (cow)
Pathway
bta04080  Neuroactive ligand-receptor interaction
bta04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    282702 (CHRNA3)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    282702 (CHRNA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    282702 (CHRNA3)
Ion channels [BR:bta04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   282702 (CHRNA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD FtsK_alpha
Motif
Other DBs
NCBI-GeneID: 282702
NCBI-ProteinID: NP_777144
Ensembl: ENSBTAG00000003130
VGNC: 27325
UniProt: Q07263
Position
21
AA seq 495 aa AA seqDB search
MARRSRLRRLLLLLLLPVASTSDAEHRLFERLFEDYNEIIRPVANVSDPVIIQFEVSMSQ
LVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYDGAEFMRVPAEKIWKPDIVLYNNAVGD
FQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLV
LIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRLPLFYTINLII
PCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLF
TMIFVTLSIVITVFVLNVHYRTPTTHTMPAWVKTIFLNLLPRVMFMTRPASNEGNTQRPR
PFYSAELSNLNCFSRIESKVCKEGYPCQDGLCGYCHHRRAKISNFSANLTRSSSSESVDA
VLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFLWVFILVCILG
TAGLFLQPLMTRDDA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggctcgccgctcccggctgcgccggctgctgcttctgcttctgctgccagtggccagc
acgtccgacgcagagcatcgcctgtttgagcgcctgtttgaagattacaacgagatcatc
cggccagtggccaatgtgtctgacccggtcatcatccagtttgaggtgtccatgtctcag
ctggtgaaggtggatgaagtaaaccagatcatggagactaacctgtggctcaagcaaatc
tggaacgactacaagctgaagtggaacccgtccgactacgacggggccgagttcatgcgc
gtccctgccgagaagatctggaagccagacattgtactgtacaacaatgctgttggggat
ttccaagtggacgacaagaccaaagctttactcaagtacacgggggaagtgacttggatc
cccccagccatctttaagagctcatgcaaaatcgacgtgacctacttcccgtttgattac
cagaactgcaccatgaagttcggttcctggtcctacgacaaggcaaaaatcgacctggtc
ctgatcggctcctccatgaacctcaaggactactgggagagcggcgagtgggccatcatc
aaagcccctggctacaagcacgacatcaagtacaactgctgcgaggagatctacccggac
atcacctactcgctctacatccggcgcctgcccctgttctacaccatcaacctcatcatc
ccctgcctgctcatctccttcctgactgtgctcgtcttctacctgccttccgactgcggt
gagaaggtgaccctctgcatctcggtgctcctctccttgaccgtgtttctcctggtgatc
accgagaccatcccgtccacctcactggtgattcccctgatcggcgagtacctgctcttc
accatgatctttgtaaccttgtccatcgtcatcaccgtcttcgtgctcaacgtgcactac
aggaccccgaccacccacacgatgcccgcatgggtgaagaccatattcttgaacttgctt
cccagggtcatgttcatgaccaggccagcaagcaacgagggcaacactcagaggccaaga
cccttctatagcgctgagctctcaaacctgaattgcttcagccgcatagagtccaaggtc
tgcaaggaaggctacccctgccaggacgggctgtgcggctactgccaccatcgcagggca
aaaatctccaatttcagtgccaacctcacgagaagctccagttctgagtctgttgacgct
gtgctgtccctctctgctctgtcaccggaaatcaaagaagctatccaaagtgtcaagtat
attgctgaaaatatgaaagcacaaaatgaagccaaagagattcaagacgattggaaatat
gttgccatggtgattgatcgtatttttctgtgggtttttatcctggtgtgcattttaggg
acggcaggattgtttctacaacccttgatgaccagggacgacgcgtaa

DBGET integrated database retrieval system