KEGG   Bos taurus (cow): 286762Help
Entry
286762            CDS       T01008                                 

Gene name
CPA1
Definition
(RefSeq) carboxypeptidase A1 precursor
  KO
K08779  carboxypeptidase A1 [EC:3.4.17.1]
Organism
bta  Bos taurus (cow)
Pathway
bta04972  Pancreatic secretion
bta04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    286762 (CPA1)
   04974 Protein digestion and absorption
    286762 (CPA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bta01002]
    286762 (CPA1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bta03110]
    286762 (CPA1)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.1  carboxypeptidase A
     286762 (CPA1)
Peptidases [BR:bta01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   286762 (CPA1)
Chaperones and folding catalysts [BR:bta03110]
 Intramolecular chaperones
  Other peptidases
   286762 (CPA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M14 Propep_M14
Motif
Other DBs
NCBI-GeneID: 286762
NCBI-ProteinID: NP_777175
BGD-bta: BT15758
Ensembl: ENSBTAG00000046169
VGNC: 27642
UniProt: P00730
Structure
PDB: 

Position
4
AA seq 419 aa AA seqDB search
MQGLLILSVLLGAALGKEDFVGHQVLRITAADEAEVQTVKELEDLEHLQLDFWRGPGQPG
SPIDVRVPFPSLQAVKVFLEAHGIRYRIMIEDVQSLLDEEQEQMFASQSRARSTNTFNYA
TYHTLDEIYDFMDLLVAEHPQLVSKLQIGRSYEGRPIYVLKFSTGGSNRPAIWIDLGIHS
REWITQATGVWFAKKFTEDYGQDPSFTAILDSMDIFLEIVTNPDGFAFTHSQNRLWRKTR
SVTSSSLCVGVDANRNWDAGFGKAGASSSPCSETYHGKYANSEVEVKSIVDFVKDHGNFK
AFLSIHSYSQLLLYPYGYTTQSIPDKTELNQVAKSAVEALKSLYGTSYKYGSIITTIYQA
SGGSIDWSYNQGIKYSFTFELRDTGRYGFLLPASQIIPTAQETWLGVLTIMEHTLNNLY
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggctgctgattttgagtgtgctgctgggggctgcccttggcaaagaggacttt
gtgggccaccaggtgctccgaatcactgccgccgatgaggccgaggtgcagacggtgaag
gagctggaggacctggagcacctgcagttggacttctggaggggccctggccagccaggc
tcccccatcgacgtccgagtgcccttccccagcctccaggctgttaaagtcttcctggaa
gcccatggcatcagatacaggatcatgatcgaggacgtgcagtccctgctagacgaggag
caggagcagatgttcgcctcccagagccgggcccgcagcaccaacacatttaactacgcc
acctaccacaccctggatgagatctatgacttcatggacctgctggtggccgagcaccca
cagcttgtcagcaaactccagattggcagaagctatgaaggccgtcccatctacgtgctg
aagttcagcactgggggaagcaaccgtccagccatctggatcgacttaggcatccattcc
agggagtggatcacccaggccactggggtctggtttgcaaagaagttcacagaagactat
ggccaggacccgagtttcaccgccattcttgacagcatggacatattcttggagattgtc
accaaccctgatggttttgccttcacccacagccagaatcgattgtggcgcaagactcga
tctgtcacgtcaagctccctctgtgttggggtggacgccaaccggaactgggatgccggc
tttgggaaggcaggagccagcagcagcccctgctcggagacttatcatggcaagtatgcc
aattctgaagtggaggtcaagtccatcgtggactttgtgaaagaccatgggaacttcaag
gccttcctctccatccacagctactcccagctcctcctctatccctatggctacacaaca
caatcaatccctgacaagactgagctgaatcaggtggctaagtccgctgttgaggccctg
aagtctctgtatgggaccagctacaagtatggcagcatcatcacaacaatttaccaagcc
agtggaggcagcattgactggtcctacaaccaaggcatcaagtactccttcacctttgaa
ctccgggacacggggcgctatggcttcctgctgccagcctcccagatcatccccacagcc
caggagacgtggctgggggttctgaccatcatggagcacacgttgaataacctctactga

DBGET integrated database retrieval system