KEGG   Bos taurus (cow): 286764Help
Entry
286764            CDS       T01008                                 

Gene name
PARP1
Definition
(RefSeq) poly [ADP-ribose] polymerase 1
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
bta  Bos taurus (cow)
Pathway
bta03410  Base excision repair
bta04210  Apoptosis
bta04217  Necroptosis
Module
bta_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:bta00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    286764 (PARP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    286764 (PARP1)
   04217 Necroptosis
    286764 (PARP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bta03032]
    286764 (PARP1)
   03036 Chromosome and associated proteins [BR:bta03036]
    286764 (PARP1)
   03400 DNA repair and recombination proteins [BR:bta03400]
    286764 (PARP1)
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     286764 (PARP1)
DNA replication proteins [BR:bta03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     286764 (PARP1)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    286764 (PARP1)
DNA repair and recombination proteins [BR:bta03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     286764 (PARP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg zf-PARP WGR PADR1 BRCT BRCT_2
Motif
Other DBs
NCBI-GeneID: 286764
NCBI-ProteinID: NP_777176
BGD-bta: BT27335
Ensembl: ENSBTAG00000000837
UniProt: P18493
Position
16
AA seq 1016 aa AA seqDB search
MAESSDKLYRVEYAKSGRASCKKCKESIPKDSIRMAFMVESPMFDGKIPHWYHLSCFWKV
GFSIWHPDVEVEGFSELRWDDQQTIKKMAETGGRTDVSGKGQDGVGSKTEKTLIDFGAGY
AKSNRSTCKSCMEKIDKGQVRLSKKVVYPDKPQLGMVDCWYHPKCFVQKREELGFRPEFS
ATHLMGFSVLTAEDQETLKKQLPAIKGERKRKGDEVDGIDEVTKKKSKKEKDKEIKLEKA
LKAQNDLIWNVKDELKKACSTNDLKELLIFNKQEVPSGESAILDRVADGMVFGALLPCEE
CSGQLVFKGDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYFKKLKIKKQDRIF
PPESSTPVGAAAPPSAASAPAAVHSGPPDKPLSNMKILTLGKLSQNKDEVKATIEKLGGK
LTGTANKASLCISTKKEVDKLNKKMEEVKEANIRVVSEDFLQDISASTKSLQELLSTHLL
SPWGAEVKVEPVEAVGPKGKSGAAPSKKSKGPVKEEGTNKSEKRMKLTLKGGAAVDPDSG
LEHNAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVGTVIGS
NKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKHPKKFYPLEIDYGQDEEAVKKLTVN
PGTKSKLPKPVQNLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQ
ALSQGSSDSHILDLSNRFYTLIPHDFGMKKPPLLNNANSVQAKVEMLDNLLDIEVAYSLL
RGGSDDSSKDPIDVNYEKLKTDIKVVDKDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFK
IEREGESQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFA
DMVSKSANYCHTSQGDPIGLILLGEAALGNMYELKHARHISKLPKGKHSVKGLGKTTPDP
SASITVDGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVHLKYLLKLKFNFKTSLW
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtcttcagacaagctctaccgggtcgagtacgccaagagcgggcgcgcgtct
tgcaagaaatgcaaagagagcatccccaaggactcgatccggatggccttcatggtggag
tcgcccatgttcgatgggaaaatcccgcactggtaccacctctcctgcttctggaaggtc
ggcttctccatctggcaccctgatgtcgaggtggaggggttctctgagctccgctgggat
gaccagcagacgatcaagaagatggccgagactggcggacggacagatgtttcaggcaaa
ggccaagatggagttggcagcaagaccgagaagacgttgattgacttcggggcagggtac
gccaagtccaacagaagcacgtgcaagagctgcatggagaagatagacaagggccaggtg
cgcctgtctaagaaggtggtgtaccccgataagccccagctgggcatggttgactgctgg
taccacccaaagtgttttgttcagaaacgggaggagctgggcttccgtcccgagttcagc
gcaacgcacctcatgggcttcagcgtcctcaccgcagaggaccaagaaaccctcaagaag
caactcccggccatcaagggtgaaagaaagagaaaaggtgatgaggtggatggaatagat
gaagtgaccaagaagaagtctaaaaaagaaaaagacaaggagattaaacttgaaaaggcc
cttaaggcccagaacgacctgatctggaatgtcaaggacgagctaaagaaagcgtgctct
acgaacgacctgaaagagttgctcatcttcaacaagcaggaagtgccttccggggagtcg
gcgatcttggaccgcgtggccgacggtatggtgtttggcgccctccttccctgcgaggaa
tgctcgggccagctggtcttcaagggcgacgcctattactgtaccggggatgtgactgcc
tggaccaagtgtatggtcaagacacagacgcccaaccggaaggagtgggtgaccccaaag
gaattccgagaaatctcttacttcaagaaactgaagatcaaaaagcaggaccgtatattc
cccccagagagcagcaccccagtgggggcagcagccccaccctccgcagcttcagcgcct
gccgctgtgcactctggccccccagacaagccattatccaacatgaagatcctgactctc
gggaaactctcccagaacaaggatgaagtgaaggccacgattgagaaactcggggggaaa
ttgacagggacggccaacaaggcctccctgtgtatcagcaccaaaaaggaggtggacaag
ttgaataaaaagatggaggaagtaaaagaagccaacatccgtgtcgtgtctgaggacttc
ctccaagacatctccgcctccaccaagagccttcaggagttgctctccacccacctcttg
tccccctggggagccgaggtgaaggtggagcctgttgaagcagtgggcccaaaggggaag
tcgggggccgcgccctccaagaagagcaagggtcccgtcaaggaggaaggtaccaacaaa
tctgaaaagaggatgaaattaactcttaaaggaggagcagctgtcgaccctgattcaggt
ctggaacacaatgcacacgtcctcgagaaaggcgggaaggtcttcagcgccaccctcggg
ctcgtggacatcgtcaaagggaccaactcctattacaagctgcagctcctggaggatgac
aaagagagcaggtactggatattcaggtcctggggccgtgtgggcacggtgattggtagt
aacaaactggagcagatgccatccaaggaggatgccattgagcattttatgaaattatat
gaagagaaaaccggaaacgcctggcactctaaaaactttacgaagcatcccaaaaagttc
taccctctggagattgactacggccaggatgaagaggcggtgaagaagttgacagtaaac
cctggcaccaagtccaagctccccaagccagtgcagaacctcattaagatgatctttgat
gtagagagtatgaagaaagccatggtggagtatgagattgaccttcagaagatgcccttg
gggaagctgagcaaaaggcagatccaggctgcatactccatcctcagtgaggtccagcag
gcactgtcccagggcagcagtgactctcacatcctggatctctccaaccgcttctacacc
ctgatcccccacgacttcgggatgaagaagcccccgctgctgaacaacgcaaacagcgtg
caggccaaggtggaaatgctagacaacctgctggatattgaggtggcctacagtctactt
aggggtggttctgatgacagcagcaaggaccccattgatgtcaactatgagaagctcaaa
actgacattaaggttgtggacaaagattccgaagaagccgagatcattaggaagtatgtg
aagaacactcacgcgaccacacacaacgcgtacgacttagaagtcgtcgacatcttcaag
atagagcgcgaaggggaaagccagcgttacaagccgtttaagcagctgcataaccggagg
ctgctgtggcacgggtccaggaccaccaacttcgcgggcatcctgtcccagggtctccgg
atagccccacctgaagcacctgtgacgggctacatgtttggtaagggaatctatttcgcg
gacatggtctccaagagtgccaactactgccacacgtcccagggagacccaataggcttg
atcctgttgggagaagctgcccttggaaacatgtatgaattgaaacatgctcgacatatc
agcaagttacccaagggcaagcacagtgtcaaaggtttaggcaaaactacccctgaccca
tcggctagtattactgtggatggtgtggaggtgcctctcgggacagggatttcatctggt
gttaatgacacctgtctgttgtataacgagtacatcgtctacgacattgctcaggtccac
ctgaagtacctgctgaagctgaagttcaactttaagacatccctgtggtga

DBGET integrated database retrieval system