KEGG   Bos taurus (cow): 286857
Entry
286857            CDS       T01008                                 

Gene name
PAX6
Definition
(RefSeq) paired box protein Pax-6
  KO
K08031  paired box protein 6
Organism
bta  Bos taurus (cow)
Pathway
bta04550  Signaling pathways regulating pluripotency of stem cells
bta04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:bta00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    286857 (PAX6)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    286857 (PAX6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bta03000]
    286857 (PAX6)
Transcription factors [BR:bta03000]
 Eukaryotic type
  Helix-turn-helix
   Paired box plus homeo domain
    286857 (PAX6)
SSDB
Motif
Pfam: PAX Homeodomain HTH_32 HTH_23 HTH_Tnp_IS1 HTH_28 Homeobox_KN
Other DBs
NCBI-GeneID: 286857
NCBI-ProteinID: NP_001035735
BGD-bta: BT15898
Ensembl: ENSBTAG00000004561
VGNC: 32598
UniProt: Q1LZF1
Position
15
AA seq 422 aa
MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRY
YETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSV
SSINRVLRNLASEKQQMGADGMYDKLRMLNGQTGSWGTRPGWYPGTSVPGQPTQDGCQQQ
EGGGENTNSISSNGEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFAR
ERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQASNTPSHIPISSSFSTSVYQPIP
QPTTPVSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCMLPT
SPSVNGRSYDTYTPPHMQTHMNSQPMGTSGATSTGLISPGVSVPVQVPGSEPDMSQYWPR
LQ
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgcagaacagtcacagcggagtgaatcagctcggtggtgtctttgtcaacgggcggcca
ctgccggactccacccggcagaagatcgtagagctagctcacagcggggcccggccgtgc
gacatttcccgaattctgcaggtgtccaacggatgtgtgagtaaaattctgggcaggtat
tacgagactggctccatcagacccagggcaatcggtggtagtaaaccgagagtagcgact
ccagaagttgtaagcaaaatagcccagtataagcgggagtgcccgtccatctttgcttgg
gaaatccgagacagattactgtccgagggggtctgtaccaacgataacataccaagtgtg
tcatcaataaacagagttcttcgcaacctggctagcgaaaagcaacagatgggcgcagac
ggcatgtatgataaactaaggatgttgaacgggcagaccggaagctggggcacccgcccg
ggttggtatccgggaacatcagtgccagggcaacctacgcaagatggctgccagcagcag
gaaggagggggagagaataccaactccatcagttccaatggagaagattcagatgaggcc
caaatgcgacttcagctgaagcggaagctgcaaagaaatagaacatcctttacccaagag
caaattgaggccctggagaaagagtttgagagaacccattatccagatgtgtttgcccga
gaaagactagcggccaaaatagatctacctgaagcgagaatacaggtatggttttctaat
cgaagggccaaatggagaagagaagaaaagctgaggaatcagagaagacaagccagcaac
acacctagtcatattcccatcagcagcagtttcagcaccagcgtctaccaacccatccca
caacccaccacgcctgtttcctccttcacctccggctccatgttgggccgaacagacaca
gccctcacaaacacatacagtgctctgccgcccatgcccagcttcaccatggcgaataat
ctgcctatgcaacccccagtccctagccagacctcctcgtactcctgcatgctgcccacc
agcccttcggtgaacgggcggagttatgatacctacacccccccacacatgcaaacacac
atgaacagccagccgatgggcacctcgggcgccacttccacaggactcatttcccctggt
gtgtcagttccagttcaagttcctggaagtgaacctgatatgtctcaatattggccaaga
ttacagtaa

DBGET integrated database retrieval system