KEGG   Bos taurus (cow): 286863Help
Entry
286863            CDS       T01008                                 

Gene name
YWHAB
Definition
(RefSeq) 14-3-3 protein beta/alpha
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
bta  Bos taurus (cow)
Pathway
bta04110  Cell cycle
bta04114  Oocyte meiosis
bta04151  PI3K-Akt signaling pathway
bta04390  Hippo signaling pathway
bta05161  Hepatitis B
bta05169  Epstein-Barr virus infection
bta05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    286863 (YWHAB)
   04151 PI3K-Akt signaling pathway
    286863 (YWHAB)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    286863 (YWHAB)
   04114 Oocyte meiosis
    286863 (YWHAB)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    286863 (YWHAB)
  09167 Infectious diseases
   05161 Hepatitis B
    286863 (YWHAB)
   05169 Epstein-Barr virus infection
    286863 (YWHAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bta03400]
    286863 (YWHAB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    286863 (YWHAB)
DNA repair and recombination proteins [BR:bta03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    286863 (YWHAB)
Exosome [BR:bta04147]
 Exosomal proteins
  Proteins found in most exosomes
   286863 (YWHAB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 FliM Peptidase_C98 Virulence_fact
Motif
Other DBs
NCBI-GeneID: 286863
NCBI-ProteinID: NP_777219
BGD-bta: BT12235
Ensembl: ENSBTAG00000016846
VGNC: 37044
UniProt: P68250 A0A140T894
Position
13
AA seq 246 aa AA seqDB search
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS
WRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFY
LKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD
AGEGEN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggataaaagtgagctggtacagaaagccaagctcgccgagcaggccgagcgc
tacgatgacatggctgcggccatgaaggcggtcacagagcaggggcacgagctctccaac
gaggagagaaacctgctgtccgtcgcctacaagaatgtggtcggcgcccgccgttcgtcc
tggcgtgtcatctccagcatcgaacagaaaactgagaggaacgagaagaagcagcagatg
ggcaaagagtaccgcgagaagatcgaggccgagctgcaggacatctgcaatgacgtgctg
gagctgttggataaataccttattcccaatgctacacaaccagaaagtaaggtgttctac
ttgaaaatgaaaggcgattattttagatatctttctgaggtggcttctggagacaataaa
caaaccactgtgtcgaactcccagcaggcttaccaagaagcatttgaaattagtaagaaa
gaaatgcagcctacacaccccattcgactggggctggcacttaatttctccgtcttttat
tatgagattctaaactctcctgaaaaggcttgcagcctggcaaaaacggcgtttgatgag
gcgattgctgaattggacacactgaatgaagagtcttacaaagacagcaccctgattatg
cagctgcttagggacaatctcactctgtggacgtcggaaaaccagggagacgaaggagat
gctggggagggagagaactaa

DBGET integrated database retrieval system