KEGG   Bos taurus (cow): 286877Help
Entry
286877            CDS       T01008                                 

Gene name
PRKCZ
Definition
(RefSeq) protein kinase C zeta type
  KO
K18952  atypical protein kinase C zeta type [EC:2.7.11.13]
Organism
bta  Bos taurus (cow)
Pathway
bta04015  Rap1 signaling pathway
bta04062  Chemokine signaling pathway
bta04071  Sphingolipid signaling pathway
bta04144  Endocytosis
bta04360  Axon guidance
bta04390  Hippo signaling pathway
bta04530  Tight junction
bta04611  Platelet activation
bta04910  Insulin signaling pathway
bta04926  Relaxin signaling pathway
bta04930  Type II diabetes mellitus
bta04931  Insulin resistance
bta04933  AGE-RAGE signaling pathway in diabetic complications
bta05165  Human papillomavirus infection
bta05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    286877 (PRKCZ)
   04390 Hippo signaling pathway
    286877 (PRKCZ)
   04071 Sphingolipid signaling pathway
    286877 (PRKCZ)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    286877 (PRKCZ)
  Cellular community - eukaryotes
   04530 Tight junction
    286877 (PRKCZ)
 Organismal Systems
  Immune system
   04611 Platelet activation
    286877 (PRKCZ)
   04062 Chemokine signaling pathway
    286877 (PRKCZ)
  Endocrine system
   04910 Insulin signaling pathway
    286877 (PRKCZ)
   04926 Relaxin signaling pathway
    286877 (PRKCZ)
  Development
   04360 Axon guidance
    286877 (PRKCZ)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    286877 (PRKCZ)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    286877 (PRKCZ)
   04931 Insulin resistance
    286877 (PRKCZ)
   04933 AGE-RAGE signaling pathway in diabetic complications
    286877 (PRKCZ)
  Infectious diseases
   05165 Human papillomavirus infection
    286877 (PRKCZ)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     286877 (PRKCZ)
Protein kinases [BR:bta01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   286877 (PRKCZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PB1 C1_1 Pkinase_C Kinase-like C1_2 APH Haspin_kinase Kdo DZR
Motif
Other DBs
NCBI-GeneID: 286877
NCBI-ProteinID: NP_001071301
BGD-bta: BT29685
Ensembl: ENSBTAG00000014119
VGNC: 33336
UniProt: A0JNH7
Position
16
AA seq 594 aa AA seqDB search
MPSRTGPKMDGSGGRGRVRLKAHYSGDLLITSLDSATTFDELCAEVREMCWLHPGHPLTL
KWVDNEGDPCTVSSQMELEEAFRLSCQHKDEGLTLHVFPSIPKEPGMPCPGEDKSIYRRG
ARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCIHCKLLVHKRCYVLVPL
TCSRHMDSVMPSQEPAVDDKSDDVDLPSEESDGIAYISSTRKHDNIKDDAEDLKPVIDGM
DGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQVYAMKVVKKELVHDDEDIDWVQ
TEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAA
EICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYI
APEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIP
RFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLGKKQALPPFQPQ
ITDDYGLDNFDTQFTSEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSTEESV
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcaggacgggccccaagatggacgggagcggcggccgcggccgcgtccgccta
aaggcgcactatagcggggacctcctcatcaccagcctggactccgccaccaccttcgac
gagctctgcgcagaggtgcgggagatgtgctggctgcacccgggccacccgctcaccctt
aagtgggtggacaatgaaggtgacccctgcactgtgtcctcccagatggagctggaggag
gccttccgcctgtcctgtcagcacaaggatgaagggctcacccttcacgttttccccagc
atccccaaggaaccaggcatgccctgtccgggagaagacaaatccatctaccgccgtgga
gccagaagatggcggaagctgtaccgcgccaacggccacctcttccaggccaagcgcttt
aacaggagagcgtactgcggccagtgcagcgagaggatatggggcctcgcgaggcagggc
tacaggtgcatccactgcaaactgctggttcataagcgctgctacgtgctcgtcccactg
acctgcagcaggcatatggattccgtcatgccttcccaggagcctgcagtggacgacaag
agcgacgacgtggaccttccctccgaggagagtgatggaattgcttatatttcttcaacc
cggaaacatgacaacattaaagatgatgctgaggacctcaagccagtcatcgacgggatg
gacgggatcaagatatctcaggggctcgggctgcaggacttcgacctgatcagggtcatc
gggcgcgggagctacgccaaggtcctgctggtgcggctgaagaagaacgaccaggtctac
gccatgaaggtggtaaagaaggagctggtccatgacgatgaggatattgactgggtacag
acagagaagcacgtgtttgagcaggcatccagcaaccctttcttggtcggcttacactcc
tgcttccagacaacaagtcggttgttcctggtcatcgagtacgtcaacgggggcgacctc
atgttccacatgcagaggcagaggaagctgcccgaggagcacgccaggttctatgctgct
gaaatttgtatcgcactcaacttcctacacgagagagggattatctaccgggacctgaag
ctggacaatgtcctccttgacgccgatggccacatcaagctgacggactatggcatgtgc
aaggaaggcctgggccctggtgatacaacaagcactttctgcggaaccccgaactacatc
gcccctgaaatcctgcgcggagaagagtatgggttcagcgtggactggtgggcgctgggc
gtgctgatgttcgagatgatggcaggccgctcccccttcgacatcatcactgacaacccc
gacatgaacactgaagactaccttttccaagtcatcctggagaagcccatccggatcccc
cggttcctgtccgtcaaggcctcccacgtgttgaaaggatttttaaacaaggaccccaag
gagaggcttggctgccggccgcagactggattttctgatatcaagtctcacgccttcttc
cgcagtatagactgggacctgctggggaagaagcaggccctcccgcccttccagccgcag
atcacagacgactatggcctggacaacttcgatacgcagttcaccagcgagccggtgcag
ctgacccctgacgacgaggacgtaatcaagaggatcgaccagtcagagtttgaagggttc
gagtacatcaacccactgctgctgtccactgaggagtccgtatga

DBGET integrated database retrieval system