KEGG   Bos taurus (cow): 287014Help
Entry
287014            CDS       T01008                                 

Gene name
NDUFV1
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial precursor
  KO
K03942  NADH dehydrogenase (ubiquinone) flavoprotein 1 [EC:7.1.1.2 1.6.99.3]
Organism
bta  Bos taurus (cow)
Pathway
bta00190  Oxidative phosphorylation
bta01100  Metabolic pathways
bta04714  Thermogenesis
bta04723  Retrograde endocannabinoid signaling
bta04932  Non-alcoholic fatty liver disease (NAFLD)
bta05010  Alzheimer disease
bta05012  Parkinson disease
bta05016  Huntington disease
Module
bta_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    287014 (NDUFV1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    287014 (NDUFV1)
  09159 Environmental adaptation
   04714 Thermogenesis
    287014 (NDUFV1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    287014 (NDUFV1)
   05012 Parkinson disease
    287014 (NDUFV1)
   05016 Huntington disease
    287014 (NDUFV1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    287014 (NDUFV1)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     287014 (NDUFV1)
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     287014 (NDUFV1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_51K NADH_4Fe-4S SLBB
Motif
Other DBs
NCBI-GeneID: 287014
NCBI-ProteinID: NP_777233
BGD-bta: BT27787
Ensembl: ENSBTAG00000021776
VGNC: 31974
UniProt: P25708
Structure
PDB: 

Position
29
AA seq 464 aa AA seqDB search
MLAARRLLGGSLPARVSVRFSGDTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRG
DWYKTKEILLKGPDWILGEVKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEG
EPGTCKDREIIRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAG
LIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPT
TVANVETVAVSPTICRRGGAWFASFGRERNSGTKLFNISGHVNNPCTVEEEMSVPLKELI
EKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALIQAQTGLGTAAVIVMDRS
TDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLCEISKQIE
GHTICALGDGAAWPVQGLIRHFRPELEERMQQFAQQHQARQAAF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgctggcggcacggcggctgctcggcgggtcgctccccgcgcgggtgtctgtgcgattc
agcggcgacacgacagcgcccaagaaaacctcatttggctcgctgaaggacgaagaccgg
atcttcaccaacctgtatggccgccatgactggaggcttaaaggtgcccagagtcgaggt
gactggtacaagacgaaggagattctgctgaaggggcctgactggatcctgggtgaggtc
aagacgtcgggcttgcggggccgtggaggtgctggcttccccactggccttaaatggagc
ttcatgaataagccctcagatggcaggcccaagtatctggtggtgaacgcggatgagggg
gagccaggcacgtgcaaggaccgagagatcatccgccacgacccccacaagctggtggaa
ggctgcctagtagggggccgggccatgggcgctcgtgccgcctacatctacatccgcggg
gagttctacaacgaggcctccaatctgcaggtagccatccgagaggcctacgaggctggt
ctgattggcaagaatgcctgcggctccggctacgatttcgacgtgtttgtggtgcgtggg
gccggggcctacatctgcggggaggagacggcgctcatcgagtccatcgagggcaaacag
ggcaagccccgcctgaagccgcctttccctgcagacgtgggagtgtttggctgccctaca
actgtggccaatgtggagactgtggccgtgtcccctaccatctgccgccgtgggggtgcc
tggtttgccagcttcggccgagagcgcaactcaggcaccaaactgttcaacatctctggc
cacgtcaacaacccctgcaccgtggaggaggagatgtctgtgccgctgaaggagctgatt
gaaaagcacgccgggggtgtcacgggtggctgggacaacctccttgctgtgatccctggc
ggctcgtccaccccgctgatccccaagtccgtgtgtgagacggtgctgatggacttcgac
gcgctgatccaggcgcagacggggctgggcacggctgccgtgatcgtcatggaccgctcg
acggacattgtgaaagccatcgcccgcctcatcgagttctacaagcatgagagctgtggc
cagtgtaccccgtgccgcgagggtgtggactggatgaacaaggtgatggcccgctttgtg
aggggagatgcccggccggcagagatcgactctctgtgtgagatcagcaagcagatcgag
ggccacaccatctgcgccctgggcgatggggctgcgtggcccgtgcagggcctgatccga
cacttccggccggagctcgaggagcggatgcagcagtttgcccagcagcaccaggccagg
caagcagctttctga

DBGET integrated database retrieval system