KEGG   Bos taurus (cow): 287016Help
Entry
287016            CDS       T01008                                 

Gene name
H2AFZ
Definition
(RefSeq) histone H2A.Z
  KO
K11251  histone H2A
Organism
bta  Bos taurus (cow)
Pathway
bta04217  Necroptosis
bta05034  Alcoholism
bta05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    287016 (H2AFZ)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    287016 (H2AFZ)
  09165 Substance dependence
   05034 Alcoholism
    287016 (H2AFZ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bta03036]
    287016 (H2AFZ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    287016 (H2AFZ)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    287016 (H2AFZ)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   287016 (H2AFZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone Histone_H2A_C CBFD_NFYB_HMF
Motif
Other DBs
NCBI-GeneID: 287016
NCBI-ProteinID: NP_777234
BGD-bta: BT14749
UniProt: P0C0S4
Position
6
AA seq 128 aa AA seqDB search
MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE
YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG
KKGQQKTV
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggctggcggtaaggctgggaaggactccggaaaggccaagacaaaggcggtttcccgc
tcgcagagagccggtttgcagttcccggtgggccgtattcatcgacacctgaaatctagg
acgactagccatggacgtgtgggcgcgactgccgctgtgtacagcgcagccatcctggag
tacctcaccgcagaggtacttgaattggcaggaaatgcatcgaaagacttgaaggtaaag
cgtattacccctcgtcacttgcaacttgctattcgtggagatgaagaattggactctctc
atcaaggctacaattgctggtggtggtgtcattccacacatccacaaatctctgattgga
aagaaaggacaacagaagactgtctaa

DBGET integrated database retrieval system