KEGG   Bos taurus (cow): 287024Help
Entry
287024            CDS       T01008                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase, endothelial
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
bta  Bos taurus (cow)
Pathway
bta00220  Arginine biosynthesis
bta00330  Arginine and proline metabolism
bta01100  Metabolic pathways
bta04020  Calcium signaling pathway
bta04022  cGMP-PKG signaling pathway
bta04066  HIF-1 signaling pathway
bta04071  Sphingolipid signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04370  VEGF signaling pathway
bta04371  Apelin signaling pathway
bta04611  Platelet activation
bta04915  Estrogen signaling pathway
bta04921  Oxytocin signaling pathway
bta04926  Relaxin signaling pathway
bta04931  Insulin resistance
bta04933  AGE-RAGE signaling pathway in diabetic complications
bta05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    287024 (NOS3)
   00330 Arginine and proline metabolism
    287024 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    287024 (NOS3)
   04371 Apelin signaling pathway
    287024 (NOS3)
   04066 HIF-1 signaling pathway
    287024 (NOS3)
   04020 Calcium signaling pathway
    287024 (NOS3)
   04071 Sphingolipid signaling pathway
    287024 (NOS3)
   04022 cGMP-PKG signaling pathway
    287024 (NOS3)
   04151 PI3K-Akt signaling pathway
    287024 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    287024 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    287024 (NOS3)
   04921 Oxytocin signaling pathway
    287024 (NOS3)
   04926 Relaxin signaling pathway
    287024 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    287024 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    287024 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    287024 (NOS3)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     287024 (NOS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15
Motif
Other DBs
NCBI-GeneID: 287024
NCBI-ProteinID: NP_851380
BGD-bta: BT18122
Ensembl: ENSBTAG00000017680
VGNC: 32174
UniProt: A0A3Q1LSD1
Structure
PDB: 

Position
4
AA seq 1205 aa AA seqDB search
MGNLKSVGQEPGPPCGLGLGLGLGLCGKQGPASPAPEPSRAPAPATPHAPDHSPAPNSPT
LTRPPEGPKFPRVKNWELGSITYDTLCAQSQQDGPCTPRRCLGSLVLPRKLQTRPSPGPP
PAEQLLSQARDFINQYYSSIKRSGSQAHEERLQEVEAEVASTGTYHLRESELVFGAKQAW
RNAPRCVGRIQWGKLQVFDARDCSSAQEMFTYICNHIKYATNRGNLRSAITVFPQRAPGR
GDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDE
APELFVLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFSAAPFSGWYM
STEIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSFQLAKVTIV
DHHAATVSFMKHLDNEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYILSPAFRYQPD
PWKGSATKGAGITRKKTFKEVANAVKISASLMGTLMAKRVKATILYASETGRAQSYAQQL
GRLFRKAFDPRVLCMDEYDVVSLEHEALVLVVTSTFGNGDPPENGESFAAALMEMSGPYN
SSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYP
HFCAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAKAAFQASCETFCVGEEAKA
AAQDIFSPKRSWKRQRYRLSTQAEGLQLLPGLIHVHRRKMFQATVLSVENLQSSKSTRAT
ILVRLDTAGQEGLQYQPGDHIGICPPNRPGLVEALLSRVEDPPPPTESVAVEQLEKGSPG
GPPPSWVRDPRLPPCTLRQALTFFLDITSPPSPRLLRLLSTLAEEPSEQQELETLSQDPR
RYEEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPNAHPGEVHLTVA
VLAYRTQDGLGPLHYGVCSTWLSQLKTGDPVPCFIRGAPSFRLPPDPYVPCILVGPGTGI
APFRGFWQERLHDIESKGLQPAPMTLVFGCRCSQLDHLYRDEVQDAQERGVFGRVLTAFS
REPDSPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATSVLQTVQRILATEGDME
LDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERHLRGAVPWAFDPPGP
DTPGP
NT seq 3618 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacttgaagagtgtgggccaggagcccgggcccccctgcggcctggggctgggg
ctgggcctcgggctatgcggcaagcagggcccagcctccccggcacctgagcccagccgg
gcccccgcacccgccaccccgcacgcgccagaccacagcccagctcccaacagccccacg
ctgacccggcctccggaggggcccaagttccctcgcgtgaagaactgggagctggggagc
atcacctacgacactctgtgcgcgcagtcccaacaggacgggccctgcactcccaggcgc
tgcctgggctccctggtgttgccccggaaactgcagacccggccctccccgggacctcca
cccgctgagcagctgctgagccaggccagggacttcatcaaccagtactacagctccatc
aagaggagcggctcccaggctcacgaggagcggcttcaggaggtggaggccgaggtggca
tccacgggcacctaccacctccgagagagcgagctggtgttcggggccaagcaggcctgg
cgcaacgcaccccgctgcgtgggccgcatccagtgggggaagctgcaggtgtttgatgcc
cgggactgcagctcagcacaggagatgttcacctacatctgcaaccacatcaagtacgcc
accaaccgcggcaaccttcgctcggccatcacagtgttcccgcagcgcgccccgggccgc
ggagacttccggatctggaacagccagctggtgcgctacgcaggctacagacagcaggat
ggctctgtgcgtggggacccagccaatgtggagatcacggagctctgcatccagcacggc
tggacccccggaaacggccgcttcgacgtgctgcccctgctgctccaggccccagacgag
gctccagagctctttgttctgccccccgagctggtccttgaagtgcccctggagcacccc
acactggagtggtttgcggccctgggcctgcgatggtatgccctcccggccgtgtccaac
atgctgctggaaatcgggggtctggagttctccgcggcccccttcagcggctggtacatg
agcacggagattggcacgcggaacctgtgtgaccctcaccgctacaatatcctggaggat
gtggccgtctgcatggacctcgacacgcggaccacctcgtccctgtggaaggacaaggcg
gccgtggagatcaacctggctgtgctgcacagctttcagctcgccaaggtgaccatcgtg
gaccaccacgccgccacggtgtccttcatgaagcacctggacaacgagcagaaggccagg
gggggctgccccgccgactgggcctggatcgtgccccccatctcaggcagcctcacgccc
gtcttccaccaggagatggtcaactacatcctgtcccctgccttccgctaccagccagac
ccctggaaagggagcgcgaccaagggcgcaggcatcaccaggaagaagacctttaaggaa
gtggccaacgcggtgaagatctctgcctcactcatgggcaccctgatggccaagcgagtg
aaagcaaccatcctgtacgcctctgagaccggccgggcccagagctacgctcagcagctg
gggaggctcttccggaaggccttcgatccccgggtcctgtgcatggatgagtatgacgtg
gtgtccctggagcacgaggcactggtgctggtggtgaccagcacctttgggaatggcgat
cccccggagaatggagagagttttgcagctgccctgatggagatgtcggggccctacaac
agctccccgcggccggaacagcacaagagttacaagatccgcttcaacagcgtctcctgc
tcagacccgctggtgtcctcctggcggcggaagagaaaggagtccagcaacacagacagt
gcgggggccctggggaccctcaggttctgtgtgttcggactgggctcccgggcatacccc
cacttctgcgccttcgcgcgagcggtggacacccggctggaagagcttggaggggagcgg
ctgctgcagctgggccagggcgatgagctctgcggccaggaagaggccttccgtggttgg
gcaaaggcggccttccaggcctcctgtgagaccttctgcgttggggaggaggccaaggcc
gccgcccaggacatcttcagccccaaacggagctggaaacgccagaggtaccggctgagc
acccaggccgagggcctccagctgctgccaggcctgatccacgtgcacagacggaagatg
tttcaggccacagtcctctcggtggaaaatctgcaaagcagcaagtccacccgggccacc
atcctggtgcgcctggacactgcaggccaggaggggctgcagtaccagccgggggaccac
ataggcatctgcccgcccaaccggccgggcctggtggaggcgctgctgagccgcgtggag
gacccgccaccgcccaccgagtctgtggctgtggagcagctggagaaaggcagcccaggc
ggccctcctcccagctgggtgcgggacccacggctgcccccgtgcacgctgcgccaggct
ctcaccttcttcctggacatcacctccccacccagcccccggcttctccgactgctcagc
accctggccgaagaacccagcgagcagcaggagcttgagaccctcagtcaggacccccgg
cgctacgaggagtggaagtggttccgctgccccacgctgctggaggtgctggagcagttc
ccgtccgtggcgctgcccgccccgctgctcctcacccagctgcccctgctgcagccccgg
tactactctgtcagctcggcccccaacgcccaccccggagaggtccacctcacagtggcc
gtgctggcgtacaggacccaagatgggctgggccccctacactacggggtctgctccaca
tggctgagccagctcaagactggagaccccgtgccctgcttcatcaggggggctccctcc
ttccggctgccgcctgacccctacgtgccctgcatcctcgtgggccctggcactggcatc
gcccccttccggggattttggcaggagaggctgcatgacattgagagcaaagggctgcag
cccgcccccatgaccctggtgttcggctgccgctgctcccaactcgaccatctctaccgc
gacgaggtgcaggacgcccaggagcgcggggtgtttggccgcgtcctcaccgccttctcc
cgggaacctgacagccccaagacctacgtacaggacatcctgagaaccgagctggctgcc
gaggtgcaccgcgtgctgtgcctcgagcggggccacatgtttgtctgcggcgatgtcact
atggcaaccagcgtcctgcagacggtgcagcgcatcttggcgacagagggcgacatggag
ctggacgaggcgggcgacgtcatcggcgtgctgcgggatcagcaacgctatcacgaggac
attttcggcctcacgctgcgcacccaggaggtgacaagccgtatacgtacccagagcttt
tccctgcaggagcggcatctgcggggcgcggtgccctgggccttcgacccgcccggccca
gacacccccggcccctga

DBGET integrated database retrieval system