KEGG   Bos taurus (cow): 317658
Entry
317658            CDS       T01008                                 

Gene name
HMGCL
Definition
(RefSeq) hydroxymethylglutaryl-CoA lyase, mitochondrial precursor
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
bta  Bos taurus (cow)
Pathway
bta00072  Synthesis and degradation of ketone bodies
bta00280  Valine, leucine and isoleucine degradation
bta00650  Butanoate metabolism
bta01100  Metabolic pathways
bta04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    317658 (HMGCL)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    317658 (HMGCL)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    317658 (HMGCL)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    317658 (HMGCL)
Enzymes [BR:bta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     317658 (HMGCL)
SSDB
Motif
Pfam: HMGL-like
Other DBs
NCBI-GeneID: 317658
NCBI-ProteinID: NP_001068600
BGD-bta: BT16088
Ensembl: ENSBTAG00000021832
VGNC: 29877
UniProt: Q29448
Position
2
AA seq 325 aa
MATVKKVLPRRLVGLATLRAVSTSSVGTFPKQVKIVEVGPRDGLQNEKNIVPTPVKIKLI
DMLSEAGLPVVEATSFVSPKWVPQMADHAEVLKGIQKFPGVNYPVLTPNFKGFQAAVAAG
AKEVAIFGAASELFTKKNINCSIDESLQRFDEILKAARAAGISVRGYVSCVLGCPYEGKI
SPAKVAEVTKKLYSMGCYEISLGDTIGVGTPGAMKDMLSAVLQEVPVTALAVHCHDTYGQ
ALANTLTALQMGVSVMDSSVAGLGGCPYAQGASGNLATEDLVYMLAGLGIHTGVNLQKLL
EAGAFICQALNRRTNSKVAQATCKL
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcgacagtgaagaaggtgctcccgcggaggctggtgggcttggcgaccctccgggct
gtcagcacctcatctgtgggtacgttcccaaagcaagtgaaaattgtggaagttggtcct
cgagacggactacaaaatgaaaagaatattgtacctactccagtgaaaatcaagctaata
gacatgctttccgaagcaggactccctgtggtagaagccaccagcttcgtgtctcccaaa
tgggttccacagatggctgaccatgctgaagtcttgaaaggcatccagaaatttcctggc
gtcaactacccagtcctgaccccaaacttcaaaggcttccaggcagcggttgctgccgga
gccaaggaagtggccatctttggagccgcctctgaactcttcaccaagaagaacatcaac
tgctccatagatgagagtttgcagcggtttgatgaaatcttgaaggcagctcgggcagcc
ggtatctctgtgcgggggtacgtctcctgtgtgcttggatgtccctacgaagggaagatc
tccccggctaaagtcgctgaggtcaccaagaagctgtactccatgggctgctacgagatc
tccctgggggacaccatcggcgtgggcacccctggggccatgaaggacatgctgtctgct
gtcctgcaggaggtgccagtgacagccctggccgtccactgccatgacacctacggccag
gccctggccaacaccttgacggccctgcagatgggagtgagtgtcatggactcttccgtg
gcaggactgggaggctgtccctatgcacagggggcgtcgggaaacttggccaccgaggac
ctggtctacatgctggccggcctgggcattcacacgggtgtgaacctccagaagcttctg
gaagctggggccttcatctgtcaagccctgaacagaagaaccaactccaaagtggctcag
gctacctgtaaactgtga

DBGET integrated database retrieval system