KEGG   Bos taurus (cow): 317694
Entry
317694            CDS       T01008                                 

Gene name
TIMP4
Definition
(RefSeq) metalloproteinase inhibitor 4 precursor
  KO
K22584  metalloproteinase inhibitor 4
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bta01002]
    317694 (TIMP4)
Peptidases and inhibitors [BR:bta01002]
 Peptidase inhibitors
  Family I35: timp family
   317694 (TIMP4)
SSDB
Motif
Pfam: TIMP
Other DBs
NCBI-GeneID: 317694
NCBI-ProteinID: NP_001039336
BGD-bta: BT15474
Ensembl: ENSBTAG00000020263
VGNC: 35873
UniProt: O97563
Position
22
AA seq 224 aa
MPQSPRPVPSWALLLRLLALLRPPGLGEACSCAPAHPQQHVCHSALAIRAKISSEKVVPA
STDPADPQKMIRYEIKQIKMFKGFEKVNDIQYIYTPFDSSLCGVKLEANSQKRYLLTGQI
LSDGKVFVHLCNYIEPWENLSFLQRESLNHHYHLNCGCQITTCYAVPCTISAPNECLWTD
WLLERKLYGYQAQHYVCMKHVDGSCSWYQGRLPLRKEFVDIIQP
NT seq 675 nt   +upstreamnt  +downstreamnt
atgccccagagtccccggcccgtgccgagctgggcgctgctgctgcggttgctggcgttg
ctgcggccgccggggctgggcgaggcgtgcagctgcgcccctgcgcacccccagcagcac
gtctgccactcggcgctcgctatccgggccaagatctccagtgagaaggtagttcctgcc
agcacagaccctgctgaccctcaaaaaatgatccggtatgaaatcaaacagataaagatg
ttcaaagggtttgagaaagtcaacgatattcagtatatttatacgccttttgattcctcc
ctctgtggggtgaaactagaagctaacagccagaagcggtatctcctgactggtcagatc
ctcagtgatggcaaagtctttgtccatctttgcaactacattgagccctgggagaacctg
tcctttctgcagagagaaagtctgaatcaccactaccatctgaactgtggctgccaaatc
accacctgctatgcggtgccctgcaccatctcggctcccaatgagtgcctctggacagac
tggctattggaacggaagctctacgggtaccaggcccagcattatgtctgcatgaagcat
gttgatggcagctgtagctggtaccagggacgcctgcccctcaggaaggagtttgttgac
atcatccagccctag

DBGET integrated database retrieval system