KEGG   Bos taurus (cow): 317708Help
Entry
317708            CDS       T01008                                 

Gene name
HTR4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
bta  Bos taurus (cow)
Pathway
bta04020  Calcium signaling pathway
bta04024  cAMP signaling pathway
bta04080  Neuroactive ligand-receptor interaction
bta04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    317708 (HTR4)
   04024 cAMP signaling pathway
    317708 (HTR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    317708 (HTR4)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    317708 (HTR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bta04030]
    317708 (HTR4)
G protein-coupled receptors [BR:bta04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    317708 (HTR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4
Motif
Other DBs
NCBI-GeneID: 317708
NCBI-ProteinID: NP_001035575
BGD-bta: BT11184
Ensembl: ENSBTAG00000010837
VGNC: 30000
UniProt: Q5E9Q5
Position
7
AA seq 402 aa AA seqDB search
MDELDANVSSKAGFRSVEKVVLLTFLSAVILMAILGNLLVMAAVCRDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPMFISFLPIMQGWNNIGIIDLERISKPRLGQD
LHVIEKRKFNQNSNSTCCIFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQI
QMLQRAGAPTEGRLQPTDQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFVD
YTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPC
STTTINGSTHVLRDAVECGGQWESQSHPPASSPLVAAQPSDT
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggacgaacttgatgctaatgtgagttccaaggcgggtttcaggtcagtggagaaggtc
gtgctgctcacatttctctcagcagttatcctgatggctatcttggggaacctgctggtg
atggcggctgtgtgcagggacaggcagctcaggaaaataaaaaccaattatttcattgtg
tctcttgcctttgcggatctgctggtgtcagtgctggtgatgcccttcggtgccattgag
ctggttcaagacatctggatttacggggagatgttctgccttgtccggacatctctggat
gtcctgctcacaacagcatcgatttttcacctgtgctgcatttctctggataggtattat
gccatctgctgccagcctttggtctataggaacaagatgacccctctgcgcatcgcatta
atgctgggaggctgctgggtcatccccatgtttatctcttttctccctataatgcaaggc
tggaataacattggaataattgatttggaaaggatatccaagccaagactgggccaggat
ttgcatgtgatagaaaaaaggaagttcaatcagaactctaactctacgtgctgtatcttc
atggtcaacaagccctacgccatcacctgctccgtggtagccttctacatcccatttctc
ctcatggtgctggcctattatcgcatctatgtcacagctaaggagcatgctcaccagatc
cagatgctacaacgggcaggagcccccacagagggcaggctgcagccaacagaccagcat
agcactcatcgcatgaggacagagaccaaagcagccaagactctgtgcatcatcatgggt
tgcttctgcctttgctgggctccattctttgttaccaatattgtggatccatttgtagac
tatactgttcccgggcaggtgtggaccgctttcctctggcttggctacatcaattctggg
ttgaacccctttctctacgccttcttgaataagtcttttagacgtgccttcctcatcatc
ctctgctgtgatgatgaacgctaccgaagaccttccattctgggccagactgtcccctgt
tcaaccacaaccattaatggatccacacatgtgctaagggatgcagtggagtgtggtggc
caatgggagagtcagtcccaccccccagcaagttctcctttggtggctgcgcagcccagt
gacacttag

DBGET integrated database retrieval system