KEGG   Bos taurus (cow): 317723Help
Entry
317723            CDS       T01008                                 

Gene name
GCSH
Definition
(RefSeq) glycine cleavage system H protein, mitochondrial precursor
  KO
K02437  glycine cleavage system H protein
Organism
bta  Bos taurus (cow)
Pathway
bta00260  Glycine, serine and threonine metabolism
bta00630  Glyoxylate and dicarboxylate metabolism
bta01100  Metabolic pathways
bta01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    317723 (GCSH)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    317723 (GCSH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCV_H Biotin_lipoyl
Motif
Other DBs
NCBI-GeneID: 317723
NCBI-ProteinID: NP_777269
BGD-bta: BT25826
Ensembl: ENSBTAG00000006795
UniProt: P20821
Structure
PDB: 

Position
18
AA seq 173 aa AA seqDB search
MALRAVRSVRAAVGGLRAISAPSAPCLPRPWGLRAGAVRELRTGPALLSVRKFTEKHEWV
TTENGVGTVGISNFAQEALGDVVYCSLPEVGTKLNKQEEFGALESVKAASELYSPLSGEV
TEINKALAENPGLVNKSCYEDGWLIKMTFSNPSELDELMSEEAYEKYIKSIEE
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcgcgcggtgcggagcgtgcgggccgcggtcggcggcctgcgcgccatctcg
gcacccagcgcgccctgcttgccgcggccctggggactgcgagcgggtgcagtccgggag
ctgcgcaccggccctgctctgctgtcggtgcggaaattcacagaaaaacacgaatgggta
acaacagaaaatggtgtcggaacagtgggaatcagcaattttgcacaggaagctttggga
gatgttgtttactgtagtctgcctgaagttgggacaaagttgaacaaacaagaggagttt
ggtgctttggaaagtgtgaaagctgctagtgaactctattctcctctatcaggagaagta
actgaaattaataaagctctagcagaaaatccaggacttgtcaacaagtcttgttacgaa
gacggttggctgatcaagatgacattcagtaacccttcagaactagatgaactaatgagt
gaagaagcatatgagaaatacataaaatctattgaggagtga

DBGET integrated database retrieval system