KEGG   Bos taurus (cow): 327678
Entry
327678            CDS       T01008                                 

Gene name
GLTP
Definition
(RefSeq) glycolipid transfer protein
Organism
bta  Bos taurus (cow)
SSDB
Motif
Pfam: GLTP
Other DBs
NCBI-GeneID: 327678
NCBI-ProteinID: NP_786993
BGD-bta: BT19793
Ensembl: ENSBTAG00000002591
VGNC: 49993
UniProt: P68265
Structure
PDB: 
1WBE 1TFJ 2BV7

Position
17
AA seq 209 aa
MALLAEHLLRPLPADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISGNITKIKAVY
DTNPTKFRTLQNILEVEKEMYGAEWPKVGATLALMWLKRGLRFIQVFLQSICDGERDENH
PNLIRVNATKAYEMALKKYHGWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKV
RLFLVNYTATIDVIYEMYTRMNAELNYKV
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcgctgctggcggagcacctgctgaggcccctgcctgcggacaagcagatcgagacg
gggcccttcctggaggcggtgtcccacctgccgcccttcttcgattgcctcggctcccca
gtgtttactcctatcaaagcggacataagtggcaacatcaccaaaatcaaagctgtctat
gacaccaacccgaccaagttccggaccctgcaaaacatcctggaggtggagaaggagatg
tacggggccgagtggcccaaagtgggggccacgctggcactgatgtggctgaagagaggc
ctgcggttcattcaggtcttccttcagagcatctgtgacggcgagcgggatgagaaccac
cccaatctcatccgcgtcaatgccaccaaggcctacgagatggccctcaagaagtaccac
ggctggattgtgcagaagatcttccaagcagcgctgtacgcggccccctacaagtccgac
ttcctcaaagcgctctccaagggccagaacgtgacggaggaggaatgcctggagaaagtc
cgcctcttcctggtcaactacacggccaccatcgatgtcatctatgagatgtacaccagg
atgaacgccgagctcaactacaaggtgtag

DBGET integrated database retrieval system