KEGG   Bos taurus (cow): 327702
Entry
327702            CDS       T01008                                 

Gene name
NDUFAB1
Definition
(RefSeq) acyl carrier protein, mitochondrial precursor
  KO
K03955  NADH dehydrogenase (ubiquinone) 1 alpha/beta subcomplex 1, acyl-carrier protein
Organism
bta  Bos taurus (cow)
Pathway
bta00190  Oxidative phosphorylation
bta01100  Metabolic pathways
bta04714  Thermogenesis
bta04723  Retrograde endocannabinoid signaling
bta04932  Non-alcoholic fatty liver disease (NAFLD)
bta05010  Alzheimer disease
bta05012  Parkinson disease
bta05016  Huntington disease
Module
bta_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
bta_M00873  Fatty acid biosynthesis in mitochondria, animals
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    327702 (NDUFAB1)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    327702 (NDUFAB1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    327702 (NDUFAB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    327702 (NDUFAB1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    327702 (NDUFAB1)
   05012 Parkinson disease
    327702 (NDUFAB1)
   05016 Huntington disease
    327702 (NDUFAB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    327702 (NDUFAB1)
SSDB
Motif
Pfam: PP-binding PP-binding_2 MinE DUF5323
Other DBs
NCBI-GeneID: 327702
NCBI-ProteinID: NP_001035578
BGD-bta: BT25538
Ensembl: ENSBTAG00000006391
VGNC: 31952
UniProt: P52505
Structure
PDB: 
5O31 5LDW 5LC5 5LDX

Position
25
AA seq 156 aa
MAVRVLCACVRRLPTAFAPLPRLPTLAAARPLSTTLFAAETRTRPGAPLPALVLAQVPGR
VTQLCRQYSDAPPLTLEGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIM
AMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
NT seq 471 nt   +upstreamnt  +downstreamnt
atggcggttcgtgtcctttgcgcctgtgtccgccgacttcccacggccttcgcgccgctg
cccaggctccccacgctagccgcggcccggccgctcagcactaccctcttcgccgcggag
acccggacgaggcctggggctccgctgccggccttggtgctcgcgcaggttccaggcaga
gttacacagctgtgccgccagtatagcgatgcaccacctttgacattggagggaatcaag
gaccgtgttctttacgtcttgaaactctatgacaagattgacccagaaaagctttcagta
aattcccattttatgaaagacctgggcttagacagtttggaccaagtggagattatcatg
gccatggaggacgaatttgggtttgaaattcctgatatagatgcggagaagttaatgtgt
ccacaagaaattgtagattacattgcagataagaaggatgtatatgaataa

DBGET integrated database retrieval system