KEGG   Bos taurus (cow): 338445Help
Entry
338445            CDS       T01008                                 

Gene name
MAOB
Definition
(RefSeq) amine oxidase [flavin-containing] B
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
bta  Bos taurus (cow)
Pathway
bta00260  Glycine, serine and threonine metabolism
bta00330  Arginine and proline metabolism
bta00340  Histidine metabolism
bta00350  Tyrosine metabolism
bta00360  Phenylalanine metabolism
bta00380  Tryptophan metabolism
bta00982  Drug metabolism - cytochrome P450
bta01100  Metabolic pathways
bta04726  Serotonergic synapse
bta04728  Dopaminergic synapse
bta05030  Cocaine addiction
bta05031  Amphetamine addiction
bta05034  Alcoholism
Module
bta_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    338445 (MAOB)
   00330 Arginine and proline metabolism
    338445 (MAOB)
   00340 Histidine metabolism
    338445 (MAOB)
   00350 Tyrosine metabolism
    338445 (MAOB)
   00360 Phenylalanine metabolism
    338445 (MAOB)
   00380 Tryptophan metabolism
    338445 (MAOB)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    338445 (MAOB)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    338445 (MAOB)
   04726 Serotonergic synapse
    338445 (MAOB)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    338445 (MAOB)
   05031 Amphetamine addiction
    338445 (MAOB)
   05034 Alcoholism
    338445 (MAOB)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     338445 (MAOB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 FAD_oxidored FAD_binding_3 Thi4 Pyr_redox_2 Pyr_redox HI0933_like AlaDh_PNT_C Pyr_redox_3 GIDA IlvN Lycopene_cycl MCRA Trp_halogenase
Motif
Other DBs
NCBI-GeneID: 338445
NCBI-ProteinID: NP_808813
BGD-bta: BT11130
Ensembl: ENSBTAG00000001288
VGNC: 31175
UniProt: P56560 A0A140T837
Position
X
AA seq 520 aa AA seqDB search
MSSKCDVVVVGGGISGMAAAKLLHDSGLNVIVLEARDRVGGRTYTLRNQKVKYVDLGGSY
VGPTQNHILRLSKELGLETYKVNEVERLIHHTKGKSYPFRGSFPSVWNPITYLDHNNLWR
TMDDMGREIPSDAPWKAPLAEQWDLMTMKELLDKICWTESSKQLAILFVNLCVTAEIHEV
SALWFLWYVKQCGGTTRIFSTSNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIHIDQ
TGENVLVETLNHELYEAKYVISAVPPVLGMKIHFNPPLPMMRNQLITRVPLGSVIKSIVY
YKEPFWRNMDYCGSMIIEGEEAPVAYALDDTKPDGSYPAIIGFILAHKARKLARLTKEER
LKKLCDLYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTSYFPPGIMTQYGRVLRQPVGR
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWLPEPESVDVPAKPITTT
FLQRHLPSVPGLLKLIGLTTIFSATALGYLAHKRGLLVRI
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaaatgcgacgtggtcgtggtggggggcggcatctcaggtatggcagcagcc
aaacttctacatgactctggcttgaatgtgattgttctggaagcccgggaccgcgtggga
ggcaggacttacacccttaggaaccaaaaagttaaatatgtggaccttggaggatcttat
gttgggccaactcagaatcatatcttaagattatccaaggagctaggattagaaacctac
aaggtgaatgaagtagagcgtctgattcaccatacaaagggcaaatcctaccccttcagg
ggctcattcccgtctgtgtggaatcctatcacctacctagatcataacaacctctggagg
acgatggatgacatgggacgagagattcccagtgatgccccgtggaaggcaccccttgca
gaacagtgggacctgatgacaatgaaggagttgctggacaagatctgctggacagaatct
tcaaagcagcttgctattctctttgtgaacctttgcgtcactgcagagatccatgaggtc
tccgctctctggttcctgtggtatgtgaagcagtgtgggggcacgaccaggatcttctca
acatccaatggagggcaggagaggaaatttgtgggtggatctggtcaagtgagtgagcgg
ataatggacctcctgggggatcgagtgaagctggagaggcctgtgatccacattgaccag
acaggagaaaatgtccttgtggagaccctaaaccatgaattgtacgaggctaagtacgtg
attagcgctgttcctcctgttctgggcatgaagattcacttcaatccccctctgccaatg
atgagaaatcagctgatcactcgtgtgcctttgggttcagtcatcaagagtatagtttat
tataaagagcccttctggagaaatatggattactgtggaagcatgattattgaaggagag
gaagctccagttgcctatgcattggatgatactaaacctgatggcagctatcctgccata
ataggatttatccttgcccacaaagccagaaagctggctcgtcttaccaaggaggaaagg
ttgaagaaactctgtgacctctatgcaaaggttctgggctcacaagaagctttgcaccca
gtgcactatgaagagaagaactggtgtgaggagcagtactccggaggctgctacacttcc
tacttccctcctgggatcatgactcaatatggaagggttctacgccagccagtgggcagg
atttactttgcaggcacagagactgccacacactggagtggctacatggagggggctgtg
gaggctggcgagagagcggcccgagagatcctgcatgccatgggcaagatcccagaggat
gaaatctggctgcctgaaccagagtctgtggatgtccctgcgaagcccatcaccaccacc
ttcttgcaaaggcatttgccctccgtgccaggcctgctgaagctgattggattgaccacc
atcttttcagcaactgctctcggctacctggcccacaagagggggctcctggtgcgaatc
taa

DBGET integrated database retrieval system