KEGG   Bos taurus (cow): 369020
Entry
369020            CDS       T01008                                 

Gene name
RETN
Definition
(RefSeq) resistin precursor
  KO
K13438  resistin
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    369020 (RETN)
SSDB
Motif
Pfam: Resistin CBM_1
Other DBs
NCBI-GeneID: 369020
NCBI-ProteinID: NP_899206
BGD-bta: BT30196
Ensembl: ENSBTAG00000004716
VGNC: 33877
UniProt: Q762I5 K9MNT8
Position
7
AA seq 109 aa
MKALSFLFIPVLGLLVCGQSLCPIDKAISEKIQEVTTSLVPGAVRIIGLDCRSVTSRGSL
VTCPSGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRLHIQ
NT seq 330 nt   +upstreamnt  +downstreamnt
atgaaggctctctccttcctcttcatcccagtcctggggctgctggtgtgtggccagtcg
ctgtgccccatagataaagccatcagtgagaagatccaggaggtcaccacctccctagtt
cctggggcagtaaggatcattggcctggactgccggagtgtcacctctagggggtccctg
gtcacctgcccttcaggcttcgccgtcactggctgcacgtgtggctccgcctgtggctcg
tgggacgtacgtgctgagaccacgtgccactgccagtgcgcaggcatggactggactgga
gctcgctgctgccgcctgcatatccagtag

DBGET integrated database retrieval system