KEGG   Bos taurus (cow): 404148Help
Entry
404148            CDS       T01008                                 

Gene name
PGAM1
Definition
(RefSeq) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bta  Bos taurus (cow)
Pathway
bta00010  Glycolysis / Gluconeogenesis
bta00260  Glycine, serine and threonine metabolism
bta01100  Metabolic pathways
bta01200  Carbon metabolism
bta01230  Biosynthesis of amino acids
bta04922  Glucagon signaling pathway
bta05230  Central carbon metabolism in cancer
Module
bta_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bta_M00002  Glycolysis, core module involving three-carbon compounds
bta_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    404148 (PGAM1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    404148 (PGAM1)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    404148 (PGAM1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    404148 (PGAM1)
Enzymes [BR:bta01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     404148 (PGAM1)
Membrane trafficking [BR:bta04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    404148 (PGAM1)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   404148 (PGAM1)
  Exosomal proteins of melanoma cells
   404148 (PGAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 404148
NCBI-ProteinID: NP_001029226
BGD-bta: BT10692
Ensembl: ENSBTAG00000012697
UniProt: Q3SZ62
Position
26
AA seq 254 aa AA seqDB search
MAAYKLVLIRHGESTWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQ
KRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYD
VPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKR
VLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPMVYELDKNLKPIKPMQFLGDEETVR
KAMEAVAAQGKAKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctacaagctggtgctgatccggcacggtgagagcacatggaacctggagaac
cgtttcagcggctggtacgacgcggacctgagcccagccgggcacgaggaggcgaagcga
ggcgggcaggcgctgagagatgctggctatgagtttgacatctgcttcacctcagtgcag
aagagagcaatccggaccctctggacagtgctggatgccattgaccaaatgtggctgcca
gtggtgaggacttggcgccttaatgagcgacactatgggggtctgactggcctcaataag
gcagaaactgctgccaagcatggtgaggcccaggtaaagatctggaggcgctcctatgat
gtcccgccacctcccatggagcccgaccatcccttctacagcaacatcagtaaggatcgc
aggtacgcagaccttactgaagaccagctgccctcctgtgagagtctgaaggacacaatt
gccagagctctgcccttttggaatgaagaaattgtcccccagatcaaggaggggaaacgg
gtactaattgcagcccatggcaacagcctccggggcatcgtcaagcatctggagggtctc
tctgaagaggctatcatggagctgaacctgccgactggcattcccatggtctatgagttg
gacaagaacttgaagcccatcaagcccatgcagttcctgggggatgaggagaccgtgcgt
aaagccatggaggctgtggctgcccagggcaaggccaagaagtga

DBGET integrated database retrieval system