KEGG   Bos taurus (cow): 404193Help
Entry
404193            CDS       T01008                                 

Gene name
FGFR2
Definition
(RefSeq) fibroblast growth factor receptor 2
  KO
K05093  fibroblast growth factor receptor 2 [EC:2.7.10.1]
Organism
bta  Bos taurus (cow)
Pathway
bta01521  EGFR tyrosine kinase inhibitor resistance
bta04010  MAPK signaling pathway
bta04014  Ras signaling pathway
bta04015  Rap1 signaling pathway
bta04144  Endocytosis
bta04151  PI3K-Akt signaling pathway
bta04550  Signaling pathways regulating pluripotency of stem cells
bta04810  Regulation of actin cytoskeleton
bta05200  Pathways in cancer
bta05215  Prostate cancer
bta05226  Gastric cancer
bta05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    404193 (FGFR2)
   04015 Rap1 signaling pathway
    404193 (FGFR2)
   04010 MAPK signaling pathway
    404193 (FGFR2)
   04151 PI3K-Akt signaling pathway
    404193 (FGFR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    404193 (FGFR2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    404193 (FGFR2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    404193 (FGFR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    404193 (FGFR2)
   05230 Central carbon metabolism in cancer
    404193 (FGFR2)
  09162 Cancer: specific types
   05226 Gastric cancer
    404193 (FGFR2)
   05215 Prostate cancer
    404193 (FGFR2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    404193 (FGFR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bta01001]
    404193 (FGFR2)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:bta04090]
    404193 (FGFR2)
   00536 Glycosaminoglycan binding proteins [BR:bta00536]
    404193 (FGFR2)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     404193 (FGFR2)
Protein kinases [BR:bta01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   404193 (FGFR2)
CD molecules [BR:bta04090]
 Proteins
  404193 (FGFR2)
Glycosaminoglycan binding proteins [BR:bta00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   404193 (FGFR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 Ig_2 ig FGFR3_TM V-set Ig_5 Ig_4 C2-set_2 Herpes_gE Kinase-like
Motif
Other DBs
NCBI-GeneID: 404193
NCBI-ProteinID: NP_001192239
BGD-bta: BT11084
Ensembl: ENSBTAG00000014064
VGNC: 28987
Position
26
AA seq 839 aa AA seqDB search
MGLTSTWRYGRGQGIGTVTMVSWGRFLCLVVVTMATLSLARPSFNLVDDTTVEPEEPPTK
YQISQPEVYVAAPRESLELRCLLRDAAMISWTKDGVHLGPNNRTVLIGEYLQIKGATPRD
SGLYACTAARNVDSETVYFMVNVTDAISSGDDEDDADGSEDFVSENSNSKRAPYWTNTEK
MEKRLHAVPAANTVKFRCPAGGNPTPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESV
VPSDKGNYTCVVENDYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVY
SDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKHSGINSSNAEVLALFNVTEADAGEYICK
VSNYIGQANQSAWLTVLPKQQAPVREKEIPASPDYLEIAIYCIGVFFIACMVVTVILCRM
RNTTKKPDFSSQPAVHKLTKRIPLRRQVSAESSSSMNSNTPLVRITTRLSSTADTPMLAG
VSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKEKPKEAVTVAVKMLKDD
ATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPP
GMEYSYDINRVPEEQMAFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKI
ADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGS
PYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILT
LTTNEEYLDLSQLLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHRNGSVKT
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atgggattaacgtccacatggagatatggaagaggacaggggatcggcactgtaaccatg
gtcagctggggtcgcttcctctgcctggttgtggtcaccatggcaaccttgtccctggcc
cggccctccttcaatttagttgacgataccacggttgagccggaagagccaccaaccaaa
taccaaatctcccaaccagaagtttacgtggctgcgccccgggagtcgctagagttgcgc
tgcctgttgcgagatgccgccatgatcagttggactaaggatggggtacacttggggccc
aacaataggacagtgcttattggggagtatttgcagataaaaggtgccacgcctagagac
tccggcctctatgcttgtactgctgctaggaacgtagacagtgagactgtctacttcatg
gtcaatgtcacagatgccatctcatccggagatgatgaggacgacgcagatggctcggag
gattttgtcagtgagaacagtaacagcaagagagcaccatactggaccaacacagaaaag
atggaaaaacggctgcacgcggtcccagcagccaacactgtcaagttccgctgtccagct
ggggggaatccaacaccaaccatgaggtggctgaaaaacgggaaggaatttaagcaggag
catcgcattggaggctataaggtacgaaaccagcattggagccttattatggaaagtgtg
gtcccgtctgacaaaggaaattatacctgcgtggtggagaacgattacgggtccatcaat
catacgtaccaccttgacgttgttgagcgatcaccacaccggcccatcctccaagccggg
ctgccggcaaatgcctccactgtggttggaggcgatgtggagtttgtctgcaaagtgtac
agcgatgcccagccccatatccagtggatcaaacacgtggaaaagaacggcagtaaatat
gggcccgacgggctgccctatctcaaggttctgaagcactcggggataaatagttccaat
gcggaagtgctggctctgttcaatgtgacggaggcggatgctggcgagtatatttgtaag
gtctccaattatatagggcaggccaaccagtctgcctggctcactgtcctgccaaaacag
caagctcctgtaagagaaaaggagatcccagcttccccagactacctggaaatagccatt
tactgcataggggtgttcttcatcgcctgcatggtggtgacggtcatcttgtgccggatg
aggaacacgaccaagaagccggacttcagcagccagccggctgtgcacaagctgaccaag
cgcatccccctgcggagacaggtttctgctgagtccagctcctccatgaactccaatacc
ccgttggtgaggattacaactcgcctctcttcaactgcagacacccccatgctggcgggg
gtctccgagtacgagctgccagaagatcccaaatgggagtttccaagagataagctgacg
ctgggcaaacccctgggagaaggttgctttgggcaagtggtcatggctgaagcagtggga
attgacaaggagaagcccaaggaagcagtcactgtggccgtgaagatgttgaaagatgat
gccactgagaaagacctttctgatctggtgtccgagatggagatgatgaagatgattggg
aaacacaaaaatatcataaatctccttggagcctgtactcaggatgggccgctctatgtc
atcgttgaatacgcctctaaaggcaaccttcgggaatacctgcgcgcccggaggccaccc
gggatggagtattcctacgacatcaaccgcgttcccgaggagcagatggccttcaaggac
ctggtgtcgtgtacctaccagctggcccggggcatggagtacttggcttcccagaaatgc
attcatcgagatttagctgccagaaatgttttggtaacagaaaacaacgtgatgaaaata
gctgactttggactggccagagatatcaacaatatagactattacaaaaagaccacaaat
ggccgacttccggtcaagtggatggctcccgaagcccttttcgacagagtgtacacccat
cagagcgatgtctggtccttcggggtgttaatgtgggagatcttcacgttagggggttcg
ccctacccagggattcccgtggaggaactttttaagctgcttaaggaaggacataggatg
gacaagccagcaaactgcaccaacgaactgtatatgatgatgagagactgctggcatgcg
gtaccctcacagagacccaccttcaagcagttggtagaagacttggatcgaattctcaca
ctcacaaccaatgaggaatacttggacctcagtcagcttcttgaacaatattcacctagt
taccctgacacaaggagttcttgctcttcgggagatgattctgttttctctccggacccc
atgccttacgaaccctgccttcctcagtatccacatagaaacggcagtgttaaaacatga

DBGET integrated database retrieval system