KEGG   Bos taurus (cow): 404546Help
Entry
404546            CDS       T01008                                 

Gene name
HSD11B1L
Definition
(RefSeq) hydroxysteroid 11-beta-dehydrogenase 1-like protein precursor
Organism
bta  Bos taurus (cow)
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Motif
Other DBs
NCBI-GeneID: 404546
NCBI-ProteinID: NP_996852
BGD-bta: BT11226
Ensembl: ENSBTAG00000001793
VGNC: 29966
UniProt: Q6Q7D1
Position
7
AA seq 287 aa AA seqDB search
MKVLLLTGLGALFFAYYWDDNFDPASLHGARVLLTGVSAGIGEELAYHYARLGSHLVLTA
HTEALLQQVVGNCRKLGAPKVFYIAADMASPEVPERVVQFALDKLGGLDYLVLNHLGAAP
AGTRVRSSQSTRWLMQMNFLSYVQLTSSALPSLTDSKGSLVVVSSLLGRVPTSFSSPYSA
AKFALDSFFSSLRRELDVQEVNVAITMCVLGLRDRASAAEGVRGITRVRAAPGPKAALAV
IRGGATRASGVFYPWRFHLLCLLRSWMPHSRAWFVRQELNITTPAAA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgctgctccttaccgggctgggagccctgttctttgcctattactgggatgac
aactttgacccagccagcctccacggagcccgtgtgctactgaccggagtcagtgccggc
ataggggaagagctggcgtatcactacgcgcgcctgggctcccacctcgtgctcactgcc
cacaccgaagctctgctgcagcaggtggtagggaactgccggaagctgggcgctcccaag
gtcttctacatcgctgcggacatggcctcccccgaggtgcccgagcgcgtggtgcagttt
gcgctggacaagctgggagggctggactacctggtgctgaaccacctcggcgccgcccca
gcaggcacgagggtccgcagctcccagtcgacacgttggctcatgcagatgaacttccta
agttacgtgcaattgacttcttcggcgctgccaagcctgactgacagcaagggctccctg
gtggtggtgtcctcattgctcggccgggtgcccacttccttctccagcccctactctgca
gccaagttcgcgctggacagcttcttcagttctctccggagggagctggacgtgcaggaa
gtgaacgtggccattaccatgtgcgttctgggtctccgagatcgtgcctcagccgccgaa
ggagtcaggggcatcacgagggtcagggccgctccagggcccaaggcagccctggccgta
atccgcggaggcgccacgcgtgcctctggggtcttctacccgtggcgcttccacctgctc
tgcctgctccgcagttggatgccacactcaagggcctggttcgtacgccaggagctcaat
ataacgacgcccgctgctgcctga

DBGET integrated database retrieval system