KEGG   Bos taurus (cow): 407107Help
Entry
407107            CDS       T01008                                 

Gene name
COL4A4
Definition
(RefSeq) collagen alpha-4(IV) chain isoform X1
  KO
K06237  collagen, type IV, alpha
Organism
bta  Bos taurus (cow)
Pathway
bta04151  PI3K-Akt signaling pathway
bta04510  Focal adhesion
bta04512  ECM-receptor interaction
bta04926  Relaxin signaling pathway
bta04933  AGE-RAGE signaling pathway in diabetic complications
bta04974  Protein digestion and absorption
bta05146  Amoebiasis
bta05165  Human papillomavirus infection
bta05200  Pathways in cancer
bta05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    407107 (COL4A4)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    407107 (COL4A4)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    407107 (COL4A4)
 Organismal Systems
  Endocrine system
   04926 Relaxin signaling pathway
    407107 (COL4A4)
  Digestive system
   04974 Protein digestion and absorption
    407107 (COL4A4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    407107 (COL4A4)
   05222 Small cell lung cancer
    407107 (COL4A4)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    407107 (COL4A4)
  Infectious diseases
   05165 Human papillomavirus infection
    407107 (COL4A4)
   05146 Amoebiasis
    407107 (COL4A4)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   407107 (COL4A4)
Glycosaminoglycan binding proteins [BR:bta00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   407107 (COL4A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen C4
Motif
Other DBs
NCBI-GeneID: 407107
NCBI-ProteinID: XP_024837496
BGD-bta: BT24021
Ensembl: ENSBTAG00000021310
VGNC: 49979
Position
2
AA seq 1689 aa AA seqDB search
MALVRRPFKCNKLLATNSWSLILILFSVQYAYGGGKKFIGLCGGRDCSLCQCFPEKGSRG
QPGPAGPQGPIGPLGPPGPTGIPGEKGMKGDSGRPGAAGDVGDKGPTGVPGFPGLDGIPG
HPGPPGSRGRPGIDGYNGSRGDPGIPGERGALGPRGPPGLPGEKGEKGNSVFILGATKGM
QGDRGDPGPPGSPGSRGVRGPAGPVGYPGEPGLAGPPGPPGSPGLKGNPGVGVKGQMGDP
GEVGQQGSPGPTLLVQPPDSGLYKGEKGIKGMPGMTGLPGPPGPRGEPGIGRKGEKGIPG
FPGPRGDPGSYGSPGFPGLKGEPGLFGDPGSFGFLGPKGDPGDRGHPGPPGVLVTPSLPL
KGPPGDPGRPGRYGETGAVGPRGPPGAPGRPGEACPGMTGPPGPRGFPGHPGFPGAAGVP
GRADSAPGKPGNQGPTGLPGVPGLPGPPGSDAVYCTVGQPGPQGTKGKVGPPGRRGSKGE
KGSSGLCACQPGPMGPSGPPGPPGRQGSKGDLGLPGWLGEKGSPGPPGAKGSPGPPGKPG
ASGLPGSKGEKGDMVVSRVKGHKGERGPDGPPGLPGQQGQHGRDGYAGEKGDTGPPGDHE
DAAPGDKGPPGPPGPPGRAGPRGPPGLGFPGPPGDRGQPGAPGYPGNRGPDGRKGRKGDT
IPCNVTYPGRPGPPGFDGPPGPKGLPGHRGAPGLRCLDGQKGQRGKPGISERPGPPGFRG
DIGEPGLGGEKGSSPVGPPGTPGSPGVNGQKGPPGDPAIGYPGLPGKSGLPGAPGSKGLR
GDAGRPGTAGPAGMPGFPGLQGPKGREGNAGFPGIPGPPGHSCERGAPGIPGQPGLPGAP
GSPGAPGWKGQRGDMGPLGPAGMKGLPGVPGWPGADGTPGLPGVPGPTGDDGLPGLPGPK
GPQGLPGFLGFPGERGKPGQDGHPGRKGEHGEKGWPGFLGDRGLKGVKGARGPPGYEGET
DIISKKGETGEPGPSGDGGFPGENGDKGHPGMQGRRGEPGSHGPPGFHPGEPGRNGQPGL
PGPPGPPGSPGLRGNIGFPGFPGDQGEPGSPGCPGPSGMDGTRGPKGDKGESASQFGLPG
PKGEPGGPGYPGRLGASGEQGLPGAQGPGGPPGRPGPPGLSGPTGCPGSPGGPGLQGPPG
EVGDPGPRGVLGDPGAPGLPGIKGPSGSPGLNGLHGLKGQKGSKGASGSHEMGPPGPVGM
PGPKGETGDPGNPGISPPGLFGERGPLGPPGPPGRAGPPGPPGAPGKALKGDIPDPGLPG
DQGPPGPDGPRGVPGPPGPPGSVDLLKGEPGDCGLPGPPGLPGPPGPPGHKGFPGCDGKH
GQKGPMGFPGPQGPPGSPGPPGDKGLPGPPGRRGPLGPPGSRGEPGPPADLDACPRIPGL
PGVPGPRGPEGTMGLPGMRGPPGPGCKGEPGLDGRRGEDGLPGSPGPPGHKGDMGEAGCP
GAPGPPGPMGDPGPIGFGPGYLSGFLLVLHSQTDGEPTCPMGMPRLWTGYSLLYLEGQER
AHNQDLGLAGSCLPIFSTLPFAYCNIHQVCHYARRNDRSYWLASTAPLPMTPLSEDEIRP
YISRCAVCEAPAQAVAVHSQDQSIPPCPRAWRSLWIGYSFLMHTGAGDQGGGQALMSPGS
CLEDFRAAPFLECQGRQGTCHFFANKYSFWLTTVRPDLQFSSAPLPDTLKESHAQRQKIS
RCQVCVKHS
NT seq 5070 nt NT seq  +upstreamnt  +downstreamnt
atggcactggtaaggcgtcctttcaagtgcaacaagctcttggccaccaattcctggtca
ctcatacttattttgttttctgtacaatatgcatatgggggtggaaagaagtttattggt
ctctgtggaggaagagattgctctctttgccagtgctttcctgaaaagggatctcggggt
caaccgggaccagcagggccacagggtcctattggacccctgggaccaccgggacccact
gggatcccaggggagaaagggatgaaaggtgacagtggccgtcctggagcagcaggtgac
gtaggtgacaagggtccaaccggagttcctggatttccaggtctggatgggatacctggg
cacccagggcctcctggatccagaggcagacctggcatagatggctacaatggctcaaga
ggtgatccagggattccaggagaaagaggagctcttggcccacgagggcccccaggcctt
cctggagaaaaaggagaaaaaggaaattcagtgttcattttaggtgccactaaaggtatg
cagggcgacagaggggacccaggacctcccggctcaccaggatcaaggggagtgagaggc
ccagcaggcccagtggggtacccaggagagcccgggttagcaggacctccaggcccccct
gggagtccaggcttaaagggtaatcctggcgtgggagtaaaggggcaaatgggagacccg
ggtgaggttggccaacaaggttctccggggcccactctgttggtgcagccacctgattct
ggtctctataaaggagaaaagggtattaaaggaatgcctggaatgactggacttcctgga
ccaccgggacccaggggagagcctggtattgggagaaaaggagagaaagggattcctggg
tttccaggacctcggggggaccctggttcctatggatctccaggttttccaggattaaag
ggggaaccaggactgtttggagatcctgggtcatttggatttcttggcccaaagggagat
cctggagaccgagggcacccaggaccaccaggggttttggtaactccatctcttccactc
aaaggccctccaggggatccagggcgccctggccgctatggagaaacaggggctgttgga
ccacgtggtcctcctggtgccccaggtagaccaggggaagcctgtccaggcatgacggga
cctcctgggccacgaggatttcctggtcacccaggatttccaggggcagctggggttcct
ggaagagctgattctgctccaggcaaaccaggcaaccagggaccaactgggctgcctgga
gtgccgggactgccgggacctccgggatcagatgctgtatattgtactgttgggcaaccc
ggaccacaaggaacaaaaggcaaagtgggtcctccaggaagacgaggctccaaaggagaa
aaagggagctcagggctctgtgcctgccagcctggtcccatgggcccatcaggccctcca
gggcctcctgggaggcaagggagtaagggagacttggggctccctgggtggcttggagaa
aaaggttccccaggccctcctggtgccaaaggatctccagggccaccgggaaaacctggt
gcctcaggactacctggcagcaaaggagaaaaaggtgacatggttgtatcaagagtgaaa
ggacacaaaggagaaagagggcctgatgggccccctggacttccagggcagcagggacaa
cacggtcgagatggatatgctggagaaaagggggacacagggccgcctggtgatcacgag
gatgcagccccaggtgataaagggcctcctggaccgccagggccccctggcagagcggga
cctagggggcccccaggcctgggatttcctggccctccaggagacagagggcaaccagga
gctccaggctacccaggcaacaggggtcctgatggtcggaagggtcggaaaggtgataca
attccttgtaacgtaacataccctgggaggccaggccctccaggttttgatggtcctcca
ggtccaaagggacttccaggtcatcggggtgctcctgggctgaggtgtttggatggacag
aagggtcaacgtggcaaaccaggaatctcagaaagacctggtccacctggttttcgtggt
gatataggagaaccaggtttgggaggtgaaaaggggtcctcgcctgttgggcccccaggc
actccaggttcacctggagtgaatggtcagaaaggacccccaggagatcctgctatcggc
tacccaggactcccgggaaagagcggtcttccaggagcaccagggtccaaaggactcaga
ggcgatgccgggcgtccagggaccgcagggccagctggcatgcccggatttccgggtctc
caaggtcccaaaggccgagagggaaatgctgggtttccagggatcccaggcccacctggt
cactcctgtgaaagaggtgctccagggataccagggcaaccggggctccctggggctcca
ggcagtccaggtgccccaggttggaaaggacagcgaggggacatgggacctctgggacct
gctggaatgaagggccttcctggagtcccaggatggccgggggcagatggaaccccaggt
cttccaggggtcccaggccccactggagacgatgggctacctggtcttccaggcccaaag
ggaccccaggggctgcctggcttcctgggttttccaggagagagaggaaaacctggtcag
gatggacaccctggcagaaagggagaacatggagagaagggttggcctggcttcctggga
gaccgaggattgaaaggtgtcaaaggagcaagaggacccccgggatatgaaggagaaacg
gatattatttccaagaagggggaaactggagaacctggaccttctggggatggtggattc
ccaggagaaaatggtgataaaggtcatcctgggatgcaaggaaggagaggagagccagga
agccatggaccacctggatttcaccctggggagcccggaagaaatggacagccagggctt
cctggacccccaggccctccaggctcacctgggctgagaggaaacattggttttccagga
tttccgggtgaccagggtgagccaggttctccagggtgcccgggaccttcaggaatggat
ggtacaagaggacctaaaggagacaaaggggaatctgcaagtcagtttggcctgcctggt
ccaaagggtgagccgggtggccctggatatccaggacgtttgggagcatctggagagcag
ggcttgcccggtgctcaaggtcctggaggaccacccggaaggccaggacctcctggcttg
tctggaccaacaggatgtccaggtagtccaggggggcctgggctgcagggacccccagga
gaagtgggggatcctggaccaagaggcgtcctgggggacccaggagcaccaggtcttcca
ggaataaaaggtccctctgggtcgcccggcctgaacggcctgcatggtttgaagggtcag
aaaggcagcaaaggcgcttcaggttcgcatgaaatgggccccccaggtccagtgggaatg
cccggccctaaaggggagacaggagaccccgggaacccaggaatttctcctccgggactt
tttggagaaagaggtcccctgggtcccccaggacccccagggagagctggaccacctggt
cctccaggtgccccaggaaaagctcttaagggtgacattccagacccgggtctgcctgga
gatcaggggcctcctggccccgacggtccaagaggagtacccgggcctccaggaccacct
gggagtgtcgaccttctgaaaggagaaccaggagactgtggtctgccagggcctccaggt
ctcccgggcccaccaggccctccaggacacaagggcttcccaggatgtgatggaaaacat
ggccagaaaggaccaatgggattcccggggccgcaggggccacctggaagtcctgggcca
cctggagacaaaggtttacctggacctccaggcagacgagggcctttgggtcctccgggt
tccagaggtgagcctgggcccccagcagacttggatgcctgcccccgaatcccagggctt
cctggggtaccaggccccagaggaccggaaggaaccatggggcttcctggcatgagaggc
ccgccgggaccagggtgcaaaggagagcctgggctggatggcaggaggggtgaggatggc
ctcccagggtcccctgggcctccgggacataaaggtgacatgggagaagcaggctgtcca
ggagcaccaggccctcctgggcccatgggggatcctgggcccatagggtttggccctgga
tacctcagtggcttcctcctggttctccacagtcagacggatggagaacccacctgcccc
atgggcatgcccaggctctggactgggtatagtctgctatacctggaaggacaggagaga
gctcacaatcaagacctcggtctggcgggctcctgcctccccatctttagcacgctgccc
ttcgcctactgcaacatccaccaggtgtgccactatgcccggaggaacgacaggtcctac
tggctggcgagcacagcgcctctgcccatgactccgctctcggaggacgagatccgcccg
tacatcagccgctgcgcagtgtgcgaggcccccgcccaggccgtggcggtgcacagccaa
gaccagtccatccccccatgtccgcgggcctggaggagcctctggatcgggtactccttc
ctcatgcacacaggcgctggggaccaaggaggcgggcaggccctcatgtccccaggcagc
tgcctagaggatttcagagccgcaccgttcctggaatgccaaggccggcagggaacttgc
cacttttttgccaacaagtatagtttctggctgacaacagtgagacctgacttgcagttt
tcctctgcaccattaccggacaccttgaaagaaagccatgctcaacgccagaaaatcagc
aggtgccaggtctgcgtgaagcatagctaa

DBGET integrated database retrieval system