KEGG   Bos taurus (cow): 407169Help
Entry
407169            CDS       T01008                                 

Gene name
ALOX12
Definition
(RefSeq) arachidonate 12-lipoxygenase, 12S-type
  KO
K00458  arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
bta  Bos taurus (cow)
Pathway
bta00590  Arachidonic acid metabolism
bta01100  Metabolic pathways
bta01523  Antifolate resistance
bta04726  Serotonergic synapse
bta04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    407169 (ALOX12)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    407169 (ALOX12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    407169 (ALOX12)
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    407169 (ALOX12)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     407169 (ALOX12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipoxygenase PLAT
Motif
Other DBs
NCBI-GeneID: 407169
NCBI-ProteinID: NP_001179265
BGD-bta: BT10598
Ensembl: ENSBTAG00000021933
VGNC: 25841
UniProt: F1MFA8
Position
19
AA seq 663 aa AA seqDB search
MGRYRILVATGASLFAGSHNRVQLWLVGARGETELELQLRPARGQKEEFEHEVPEDLGPL
QFVKLRKHHSLVEDAWFCDRITVRGPGACEEAAFPCYRWVQGDGVLCLPEATARLAGNNA
LDVFQRHREKELKERHKIYRWATWKEGLPLTIAAGSEDDLPANMRFHEEKRLDFEWTLKA
GALEMVLKRVYTLLSSWTSLEDFDLIFWGQKSPLAEKVHQCWRDDELFGYQFLNGANPML
LRRCTSLPSRLVLPSGMEELRAQLERELQNGSLFEADFILLDGIPANVIRGEKQYLAAPL
VMLKMDPSGKLLPMVIQIQPPSPISPTPPLFLPSDPPLAWLLAKTWVRNSDFQLHQLQYH
LLNTHLLAEVIAVATMRCLPGLHPVFKLLMPHIRYTMEINTRARTQLISDGGIFDKAVST
GGGGHVHLLRRALAQLTYRSLCPLDDLADRRLLGTPGALYACDALRLWEITARYVEGIVH
LFYHGDDVVKGDPELQAWCREITEVGLRQAQERGFPVSFQSQNQLCHFLTMCVFTCTAQH
GAINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAITWHLGRR
QPDMVPLGHHKEKYFSDPKAKSVLNQFQTDLENLEREITARNEQLDLPYEYLKPSHIENS
VTI
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgggccgctaccgcatcctcgtggccaccggggcctcgctcttcgccggctcgcacaac
cgcgtgcagctgtggctggtcggggcgcgcggggaaacggagctggagctgcagctgcgg
ccggcgcggggccagaaggaggagtttgaacacgaagttccggaggacctggggccgttg
cagttcgtgaagttgcgcaaacaccactccctggtggaggacgcgtggttctgcgaccgc
atcacggtgcggggccctggagcctgcgaggaggccgcgttcccgtgctaccgctgggtg
cagggtgacggcgtgctgtgcctgccagaggccaccgcccgcctggcaggaaacaatgca
ttggacgtgttccagagacatcgagagaaggagctgaaagaaagacataagatataccgc
tgggccacctggaaggaagggttacctctgacaatagctgcaggctctgaagacgatcta
cctgcaaatatgagattccacgaggagaagaggctggactttgagtggacactgaaggcg
ggggctctggagatggtcctcaaacgtgtttacaccctcctgagctcctggaccagtctg
gaggattttgatctcatcttctggggccagaagagccccctggctgagaaggttcaccag
tgctggcgggacgatgagttgtttggctaccagtttctcaatggcgccaaccccatgctg
ttgagacgctgcacctctctgccctcccggctggtgctgccctcggggatggaggagcta
cgggcccagctggagagagaactccagaacggttccctgtttgaggctgatttcatcctc
ctggacggaattccagccaatgtgatccgaggagagaagcagtacctggctgcccccctc
gtcatgctcaagatggaccccagtgggaagctgctacccatggtcatccagatccagcct
cccagccccatctccccgacccccccattgttcctgccctcggatcctccacttgcctgg
ctcctggcaaagacctgggtccgaaattcagatttccaactgcatcagctccaataccat
ctgctcaacacccatctgctggctgaggtcatcgctgtggccaccatgaggtgcctccca
gggctgcaccctgtcttcaagctcctgatgccacacatccgctacacgatggaaatcaac
accagggcacggactcagctcatctcagacggaggcatatttgataaagcagtgagcacc
ggtggagggggccatgtgcacttgctccgccgggccctggctcagctgacctaccgctcc
ctctgtcctcttgacgatctggctgatcgccgcctgctgggaaccccgggtgctctctac
gcctgtgatgctttacggctctgggaaatcactgcccggtatgtggaggggattgtccac
ctcttctaccatggggacgacgttgtaaaaggggaccctgagctgcaggcctggtgtcgg
gagatcactgaggtggggctgcgccaggcccaggagcgaggcttccctgtctccttccag
tcccagaatcaactctgccatttccttaccatgtgtgtcttcacgtgcactgctcagcat
ggggccatcaaccagggccagctggactggtatgcctgggtccctaatgccccttgcaca
atgcggatgcccccacccaccactaaggaagatgtgacaatggccacagtgatgggctca
ctacctgatgtccgacaagcctgtcttcaaatggccatcacatggcatctgggtcgccgt
cagccagacatggtgcctctggggcatcacaaagaaaagtatttctcagaccccaaggcc
aaatctgtactaaaccaattccaaacagatctggaaaacttggaaagggaaattacagcc
cgcaatgagcaacttgacctgccctatgaatacctaaagcccagccacatagagaacagc
gtcactatttga

DBGET integrated database retrieval system