KEGG   Bos taurus (cow): 407222Help
Entry
407222            CDS       T01008                                 

Gene name
ST6GALNAC6
Definition
(RefSeq) alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
  KO
K03376  N-acetylgalactosaminide alpha-2,6-sialyltransferase (sialyltransferase 7F) [EC:2.4.99.-]
Organism
bta  Bos taurus (cow)
Pathway
bta00604  Glycosphingolipid biosynthesis - ganglio series
bta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    407222 (ST6GALNAC6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bta01003]
    407222 (ST6GALNAC6)
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.-  
     407222 (ST6GALNAC6)
Glycosyltransferases [BR:bta01003]
 Terminal extension
  Sialyltransferase
   407222 (ST6GALNAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 407222
NCBI-ProteinID: NP_001001151
Ensembl: ENSBTAG00000044129
VGNC: 35342
UniProt: Q08E15
Position
11
AA seq 332 aa AA seqDB search
MACPRPLSQCDHTPLPGPPAGHWPLPLSRRRREMKSNKEQRSAVFVILFALITILILYSS
SSANEVFHYGSLRGRTRRPVNLRKWSITDGYIPILGNKTLPSRCGQCVIVTSSSHLLGTK
LGPEIERAECTIRMNDAPTTGYSADVGNKTTFRVVAHSSVFHVLRRPQEFVNRTPETVFI
FWGPPNKMQKPQGSLVRVIQRAGLVFPNMEAYAISLSRMRQFDDLFRSETGKDREKSHSW
LSTGWFTMVIAVELCDHVHVYGMVPPDYCSLRPHLQRMPYHYYEPKGPDECVTYIQNENS
RKGNHHRFITEKRVFSSWAQLYGITFSHPSWT
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcttgcccgaggcccctcagccagtgtgaccacacacccctacctgggccacctgca
ggacactggcccctgcccctcagcagacgccggagagagatgaagagcaacaaagagcag
cggtcagcagtgttcgtgatcctctttgccctcatcaccatcctcatcctctacagctcc
agcagtgccaatgaggtctttcattatggctccctgcggggccggacacgccggcctgtc
aacctcaggaagtggagcatcactgacggatacatccccattcttggcaacaagacgctg
ccctccaggtgcggccagtgtgtgattgtcaccagctccagccacctgctgggcaccaag
ctgggtcctgagatcgaacgggccgagtgcacaatccgcatgaacgacgcacccactacg
ggctactcggccgatgtgggcaacaagaccaccttccgcgtggtggcccattccagcgta
ttccatgtgctgcggaggcctcaggagtttgtcaaccggacccctgaaactgtgttcatc
ttctggggccccccaaacaagatgcagaagccccagggaagcctggtgcgcgtcatccag
cgggcaggcctggtgttccccaacatggaggcctatgccatctccctcagccgcatgcgc
cagtttgacgacctcttccggagtgagacaggcaaggacagggaaaagtcccactcgtgg
ttgagcacaggctggttcaccatggtgattgcagtggagttgtgtgaccatgtgcacgtc
tatggcatggtgccccccgactactgcagcctgcggccccacctgcagcgtatgccctac
cactactatgagcccaaggggccagacgaatgtgtcacctacatccagaacgagaacagc
cgcaagggcaaccaccaccgcttcatcacggagaagagggtcttctcatcctgggcccag
ctgtacggaatcaccttctcccacccctcctggacctag

DBGET integrated database retrieval system