KEGG   Bos taurus (cow): 407230
Entry
407230            CDS       T01008                                 

Gene name
HTR2A
Definition
(RefSeq) 5-hydroxytryptamine receptor 2A
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
bta  Bos taurus (cow)
Pathway
bta04020  Calcium signaling pathway
bta04080  Neuroactive ligand-receptor interaction
bta04540  Gap junction
bta04726  Serotonergic synapse
bta04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    407230 (HTR2A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    407230 (HTR2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    407230 (HTR2A)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    407230 (HTR2A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    407230 (HTR2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bta04030]
    407230 (HTR2A)
G protein-coupled receptors [BR:bta04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    407230 (HTR2A)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 407230
NCBI-ProteinID: NP_001001157
BGD-bta: BT12143
Ensembl: ENSBTAG00000013498
VGNC: 29996
UniProt: Q75Z89
Position
12
AA seq 470 aa
MDILCEENTSLSSTTNSLMQLHADTRLYSTDFNSGEGNTSNAFNWTVDSENRTNLSCEGC
LSPPCFSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSTLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADENFVLIGSF
VAFFIPLTIMVITYFLTIKSLQKEATLCVSDPGTRTKLASFSFLPQSSLSSEKLFQRSIH
REPGSYGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNRDVIEAL
LNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYKS
SQLQMGPKKNSKKDDKTTDNDCTMVALGKEHPEDAPADSSNTVNEKVSCV
NT seq 1413 nt   +upstreamnt  +downstreamnt
atggatattctctgtgaagaaaacacttctttgagctcaactacgaactccttaatgcaa
ttacatgctgacacaaggctctacagtactgactttaactccggagaaggtaacacttcg
aatgcatttaactggaccgtggactcagaaaatcgaaccaacctttcctgtgagggctgt
ctctcaccaccctgcttctccttacttcatctccaggaaaagaactggtctgctctgttg
acagcggtagtgattatactaaccattgccggaaacatactcgtcatcatggcagtgtcc
ctagagaaaaagctgcagaatgccaccaactatttcctgatgtcactcgccatagctgat
atgctgctgggtttcctggtcatgcccgtgtccacgttaaccatcctctatgggtaccgg
tggcctctgcccagcaagctctgcgctgtttggatttacctggatgtgctcttctccacg
gcctccatcatgcatctgtgtgctatctccctggaccgctatgttgccattcagaacccc
atccatcacagccggttcaactccagaactaaggcatttctgaaaataattgctgtttgg
acgatatcagtgggtatatccatgccaataccagtctttgggctccaggacgattccaaa
gtctttaaggaagggagttgcttactcgcggatgagaactttgtcctgattggctctttc
gtggcctttttcattcccttaaccatcatggtgatcacctactttctcaccatcaagtcg
ctccagaaagaagccactttgtgtgtgagtgatcctggaacacggaccaaattagcttct
ttcagcttcctgcctcagagctccctgtcttcggaaaagctcttccagcggtccatccac
agggagccaggctcctacggcaggaggactatgcagtccatcagcaacgagcagaaggct
tgcaaggtgctgggcatcgtcttcttcctgtttgtggtgatgtggtgccccttcttcatc
accaacataatggctgtcatctgcaaagagtcctgcaacagggatgtcatcgaagccctg
ctcaacgtgttcgtttggatcggttacctctcctcagcagtcaacccgctggtgtataca
ctgttcaataagacctataggtctgccttttccaggtatattcagtgtcagtacaaggaa
aataaaaaaccattgcagttaattttagtgaacactatcccggccttggcttataagtcc
agtcaactccaaatgggacctaaaaagaattcgaagaaagatgacaagacgacagataat
gactgcactatggttgctctaggaaaagagcatcccgaagatgctcctgcagacagtagc
aacacagtgaacgaaaaggttagctgtgtctga

DBGET integrated database retrieval system