KEGG   Bos taurus (cow): 408001
Entry
408001            CDS       T01008                                 

Gene name
MAP1LC3B
Definition
(RefSeq) microtubule-associated proteins 1A/1B light chain 3B
  KO
K10435  microtubule-associated protein 1 light chain
Organism
bta  Bos taurus (cow)
Pathway
bta04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    408001 (MAP1LC3B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bta04131]
    408001 (MAP1LC3B)
   03029 Mitochondrial biogenesis [BR:bta03029]
    408001 (MAP1LC3B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bta04812]
    408001 (MAP1LC3B)
Membrane trafficking [BR:bta04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    408001 (MAP1LC3B)
Mitochondrial biogenesis [BR:bta03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    408001 (MAP1LC3B)
Cytoskeleton proteins [BR:bta04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     408001 (MAP1LC3B)
SSDB
Motif
Pfam: Atg8 APG12 Rad60-SLD
Other DBs
NCBI-GeneID: 408001
NCBI-ProteinID: NP_001001169
BGD-bta: BT25974
Ensembl: ENSBTAG00000011632
UniProt: O41515
Position
18
AA seq 125 aa
MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNM
SELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPICEVYESEKDEDGFLYMVYASQETFG
MKLSV
NT seq 378 nt   +upstreamnt  +downstreamnt
atgccgtccgagaaaaccttcaaacagcgccgaaccttcgaacaaagagtagaagatgtc
cgacttatccgagagcagcatcctaccaaaatcccggtaataatagaacgatacaaaggt
gagaaacagcttcctgtcctggataaaacaaagtttctggtgcctgatcatgtcaacatg
agtgagctcatcaagataataagaaggcgcttacagctcaatgctaatcaagccttcttc
ctgttagtgaatggacatagcatggtgagtgtgtccactccgatttgtgaagtgtatgaa
agcgagaaggatgaagatggattcctgtatatggtatacgcctctcaggagacttttgga
atgaaattatctgtgtaa

DBGET integrated database retrieval system