KEGG   Bos taurus (cow): 408017Help
Entry
408017            CDS       T01008                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor isoform X1
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04014  Ras signaling pathway
bta04015  Rap1 signaling pathway
bta04022  cGMP-PKG signaling pathway
bta04066  HIF-1 signaling pathway
bta04068  FoxO signaling pathway
bta04072  Phospholipase D signaling pathway
bta04150  mTOR signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04152  AMPK signaling pathway
bta04211  Longevity regulating pathway
bta04213  Longevity regulating pathway - multiple species
bta04520  Adherens junction
bta04910  Insulin signaling pathway
bta04913  Ovarian steroidogenesis
bta04923  Regulation of lipolysis in adipocytes
bta04930  Type II diabetes mellitus
bta04931  Insulin resistance
bta04932  Non-alcoholic fatty liver disease (NAFLD)
bta04960  Aldosterone-regulated sodium reabsorption
Module
bta_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    408017 (INSR)
   04015 Rap1 signaling pathway
    408017 (INSR)
   04010 MAPK signaling pathway
    408017 (INSR)
   04066 HIF-1 signaling pathway
    408017 (INSR)
   04068 FoxO signaling pathway
    408017 (INSR)
   04072 Phospholipase D signaling pathway
    408017 (INSR)
   04022 cGMP - PKG signaling pathway
    408017 (INSR)
   04151 PI3K-Akt signaling pathway
    408017 (INSR)
   04152 AMPK signaling pathway
    408017 (INSR)
   04150 mTOR signaling pathway
    408017 (INSR)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    408017 (INSR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    408017 (INSR)
   04923 Regulation of lipolysis in adipocyte
    408017 (INSR)
   04913 Ovarian Steroidogenesis
    408017 (INSR)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    408017 (INSR)
  Aging
   04211 Longevity regulating pathway - mammal
    408017 (INSR)
   04213 Longevity regulating pathway - multiple species
    408017 (INSR)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    408017 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    408017 (INSR)
   04931 Insulin resistance
    408017 (INSR)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     408017 (INSR)
Protein kinases [BR:bta01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   408017 (INSR)
CD molecules [BR:bta04090]
 Proteins
  408017 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 408017
NCBI-ProteinID: XP_002688878
BGD-bta: BT11831
Ensembl: ENSBTAG00000012687
VGNC: 30221
Position
7
AA seq 1382 aa AA seqDB search
MGAGGGRGAAAVLLMVVVAALLVGAAGHLYPGEVCPGMDIRNNLTRLHELANCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTSEGLCCHSECL
GNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHNKCKNSRRQG
CHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGC
TIINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSYIRTSYDKILLKWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPTRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWE
RQAEDSELYELDYCLKGLKLPSRTWSPPFESEGSQKHNQSEYEESAGECCSCPKTDSQIL
KELEESSFRKTFEDYLHNVVFIPRKSSSGPVAEDARPSRKRRALGDVGNVTAAVPTALGL
PNTSSTSTPMSSEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDSPEERCSVAAYV
SARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGEEELHLCV
SRRHYALERGCRLRGLLPGNYSVRVRATSLAGNGSWTEATYFYVTDYLDVPSNIAKIIIG
PLIFVFLFSVVIGSICLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVPR
EKITLLRELGQGSFGMVYEGNARDIVKGEAETRVAVKTVNESASLRERIEFLNEASVMKG
FTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMA
AEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPV
RWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDN
CPERVTDLMRMCWQFNPKMRPTFLEIVDLLKDDLHPSFPEVSFFHSEENKAPESEELEME
FEDMESVPLDRASHAQREEAGGRDGGSALGLKRNYDEHIPYTHMNGGKKNGRILTLPRSN
PS
NT seq 4149 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccgggggcgggaggggggcggcagccgtgctgctgatggtggtcgtcgccgcg
ctgctggtgggcgccgcgggccacctgtaccctggagaagtgtgccccggtatggatatc
cggaataatctcacccggctgcatgagctggccaactgctcagtcatcgaaggacatttg
cagattctgttgatgttcaaaacgagacctgaggacttccgagacctcagtttccccaaa
ctcatcatgatcactgattacttgctgctcttccgggtctatgggctggagagcctgaag
gacttgttccccaacctcacagttatccgaggctcacgcctcttctttaattatgcactg
gtcatctttgagatggttcacctgaaggagcttggcctctacaacctgatgaacatcacc
cgggggtctgtccgcattgagaagaacaatgaactctgctacctggccaccatcgactgg
tctcgcatcctggattccgtggaggataattatatcgtgctgaacaaagacgacaatgag
gagtgtggggacatttgtccaggcaccgccaagggcaagaccaactgccctgccactgtc
atcaacgggcaatttgtggagcggtgctggacacacagccactgccagaaagtgtgtccg
accatctgcaagtcacatggctgcacctctgagggtctctgctgccacagcgagtgcttg
ggcaactgctcagagcccgacgaccccaccaagtgtgtggcctgtcgcaacttctacctg
gacggcaggtgtgtggagacctgcccgcccccttactaccacttccaagactggcgctgc
gtgaacttcagcttctgccaggacctgcacaacaaatgcaagaactctcggaggcaaggc
tgccaccagtatgtcattcacaataacaagtgcatccccgagtgcccctctggctacacg
atgaattccagcaacttgatgtgtaccccttgcctgggcccctgtcccaaggtatgccac
ctcctggaaggcgagaagaccatcgattcggtgacatctgcccaggagctccgaggctgc
accatcatcaacggaagcttaatcatcaacattcgagggggcaacaacctggcagctgag
ctagaggccaaccttggactcattgaagaaatttcaggatatctgaaaatccgccggtcc
tatgccctggtgtcactttccttcttccggaagttacgtctgattcgaggggagaccttg
gaaattgggaactactctttctacgccttggacaaccagaacctaaggcagctgtgggac
tggagcaaacacaacctcaccatcactcaggggaaactcttcttccactataaccccaaa
ctctgcctgtcggaaattcacaagatggaggaagtttcaggaaccaaggggcgccaggag
agaaatgacattgctctaaagaccaatggggaccaggcatcctgtgaaaatgaattactt
aaattttcttacattcggacatcttacgacaagatcttgctaaaatgggagccgtattgg
cctcctgacttccgagacctcctggggttcatgttgttctacaaagaggccccttaccag
aacgtgacagaattcgatgggcaggatgcctgcggctccaacagctggacagtggtggat
attgacccgcctacgaggtccaacgaccccaagtcacagaaccaccctgggtggctgatg
cgtggtctcaagccctggacccagtatgccatctttgtcaagaccctggtcaccttttct
gatgaacgccgtacatacggggccaagagtgacatcatctatgtccagacagacgccact
aatccttccgtgcccctggatcccatctcagtttctaattcctcgtcccagattattctg
aagtggaagcctccctccgaccccaatggcaatatcacacactacttggtgttctgggag
agacaggcggaagacagtgagctgtatgaactggattattgcctcaaagggttgaagctg
ccctcccggacctggtctccaccattcgagtcggagggctcccagaagcacaaccagagt
gagtatgaggagtctgctggcgaatgctgctcctgcccaaagaccgactcgcagatcctc
aaggagctggaggagtcctcgttcaggaaaacgtttgaagattacctgcacaacgtggtt
ttcatccccagaaaatcatcttcaggccctgttgccgaggacgctaggccttcgaggaaa
cgcagagcccttggtgatgtggggaatgtgacagcagccgtgcccactgctctggggctc
cccaatacctcctccaccagcacgcccatgagctcggaggagcacagacccttcgagaaa
gtggtgaacaaggagtcgctggtcatctccggcctgcgtcactttactggctatcgcatc
gagcttcaggcttgcaaccaagattcccccgaggagaggtgtagcgtggctgcctatgtc
agcgccaggaccatgcctgaagccaaggcagatgatattgtcggccccgtgacccatgaa
atcttcgagaacaacgttgttcacttgatgtggcaggagcccaaggaacccaacggtctg
attgtgctgtatgaagtgagttaccgacgatatggcgaggaggagctgcacctctgcgtc
tcccgccgacattatgctctggagcgtggctgccggctgcgtgggctgctgcctgggaat
tacagtgtgcgagttcgggccacctccctggcaggcaatgggtcttggacggaagccacc
tatttctacgtgacagactatttagacgtgccatcaaatattgcaaaaatcatcatcggt
cccctcatctttgtctttctcttcagtgttgtgattggaagtatttgtctattcctgaga
aagaggcagccagatgggccattgggaccactgtatgcttcttcaaacccagagtacctc
agtgccagcgatgtgtttccatgctctgtgtatgtgccggacgagtgggaggtgcctcga
gagaagatcacactcctgcgagaattggggcaaggctcctttggcatggtgtacgagggc
aacgccagggacattgtcaagggtgaggcggagacgcgcgtggcagtgaagacggtcaac
gagtcagccagcctgcgagagcggatcgagtttctcaacgaggcttcggtcatgaagggc
ttcacctgccaccatgtggtccgcctcctgggggtggtgtccaaaggccagccaacgctg
gtggtgatggagttgatggctcacggagacctgaagagttacctccgttccctgcggcct
gaggctgagaataaccccggccgccctccgcctaccctgcaagaaatgattcagatggcg
gcagagatcgccgatgggatggcatacctgaacgctaagaagttcgtgcaccgggatctt
gcagcccggaactgcatggttgcccacgactttacagtcaaaattggagactttggaatg
acaagagacatctatgaaacggattactaccggaaagggggcaaaggtctgctccccgtg
cggtggatggcacctgaatccctgaaggacggagtcttcaccacctcttcagacatgtgg
tcttttggtgtggtcctttgggaaattaccagcttggcagaacagccttaccaaggtcta
tcaaatgagcaggtgctgaaatttgtcatggatggagggtacctggatcaacctgacaat
tgtccagagagagtcaccgacctgatgcggatgtgctggcagttcaaccccaagatgcgt
ccaaccttcctggagatcgtggacctgctcaaggacgacctgcaccccagctttcccgaa
gtgtccttcttccacagcgaggagaacaaggcgcccgagagcgaggagctggaaatggag
tttgaggacatggagagcgtgcccctggaccgggcctcgcacgcgcagagagaggaggcc
gggggccgggatggagggtcggcgctggggctaaagcgaaactatgacgagcacatcccc
tacacccacatgaacgggggcaagaaaaacggacggattctgactttgccccggtcaaat
ccttcctaa

DBGET integrated database retrieval system