KEGG   Bos taurus (cow): 414347
Entry
414347            CDS       T01008                                 

Gene name
CCL4
Definition
(RefSeq) C-C motif chemokine 4 precursor
  KO
K12964  C-C motif chemokine 4
Organism
bta  Bos taurus (cow)
Pathway
bta04060  Cytokine-cytokine receptor interaction
bta04061  Viral protein interaction with cytokine and cytokine receptor
bta04062  Chemokine signaling pathway
bta04064  NF-kappa B signaling pathway
bta04620  Toll-like receptor signaling pathway
bta04623  Cytosolic DNA-sensing pathway
bta05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    414347 (CCL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    414347 (CCL4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    414347 (CCL4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    414347 (CCL4)
   04623 Cytosolic DNA-sensing pathway
    414347 (CCL4)
   04062 Chemokine signaling pathway
    414347 (CCL4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    414347 (CCL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bta04052]
    414347 (CCL4)
Cytokines and growth factors [BR:bta04052]
 Cytokines
  Chemokines
   414347 (CCL4)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 414347
NCBI-ProteinID: NP_001068615
BGD-bta: BT10109
Ensembl: ENSBTAG00000025257
UniProt: Q17QA1
Position
19
AA seq 92 aa
MKLCVTVLSLLVLMAAFCSPALSAPMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQ
PAVVFQTKKGRQVCANPSEPWVQEYVDDLELN
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaagctctgcgtgactgtcctgtccctcctcgtgctcatggctgccttctgttctcca
gcgctctcagcaccaatgggctcagaccctcccacggcctgctgcttctcttacactctg
cggaagattcctcgcaactttgtgaatgactacttcgagaccagcagcctctgctcccag
ccagctgtggtattccagaccaaaaagggcaggcaggtctgcgccaaccccagtgagccc
tgggtccaggagtacgtggatgaccttgaattgaactga

DBGET integrated database retrieval system