KEGG   Bos taurus (cow): 497016
Entry
497016            CDS       T01008                                 

Gene name
FCN1
Definition
(RefSeq) ficolin-2 precursor
  KO
K10104  ficolin
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:bta04091]
    497016 (FCN1)
Lectins [BR:bta04091]
 Ficolins
  497016 (FCN1)
SSDB
Motif
Pfam: Fibrinogen_C Collagen
Other DBs
NCBI-GeneID: 497016
NCBI-ProteinID: NP_001010996
Ensembl: ENSBTAG00000048155
UniProt: Q5I2E5
Position
11
AA seq 329 aa
MELGGAAGALGPSGPLLVCLCFGTLAAQAADTCPEVKLVGLEGSDKLSILRGCPGLPGAP
GLKGETGAAGLKGERGLPGVPGKAGPAGPKGSTGAQGEKGARGEKGESGQLHSCATGPRT
CTELLTRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRKDGSVDFFRTWTAYKQ
GFGSQLGEFWLGNDNIHALTAQGTSELRVDLMDFEGNHRFAKYQSFRMADEAEKYKLVLG
AFVEGNAGDSLTDHGNHFFSTKDRDNDESPSNCAAQFQGAWWYHSCHSSNLNGRYLRGPH
TSYANGINWKSWGRYNYSYKVSEMKLRLT
NT seq 990 nt   +upstreamnt  +downstreamnt
atggagctgggaggcgcggccggggccctggggcccagtggcccgctcctcgtgtgcctg
tgcttcgggaccctcgctgcccaggctgcagacacatgtccagaggtgaagctggtgggt
ctggagggctccgacaagctgtccatcctccgaggctgcccagggctgcccggagcccca
gggctcaagggagagacgggtgccgctggactgaagggagaacgaggtttgcccggagtc
cctgggaaggcagggccggctggacccaaaggaagcacaggagcccaaggggagaagggt
gcacgtggagagaaaggagagtcggggcagcttcattcatgtgccacaggacctcggacc
tgcacggagctgctcaccaggggacactttctgagcggctggcacaccatctacctgccc
gactgccggcccctgactgtgctgtgtgacatggacaccgacggcggggggtggaccgtt
ttccagcgaaggaaggacggctctgtggacttcttccggacctggaccgcgtacaagcag
ggcttcggcagtcagctgggcgagttctggctggggaatgacaacatccacgccctgacc
gcccagggaaccagtgagctccgggtagacctcatggactttgaaggcaaccaccgattt
gccaagtaccagtcattcaggatggcagatgaagctgagaagtacaagctggtcctggga
gcctttgtggagggcaatgcaggtgactccctgacggaccacggaaatcacttcttctcc
accaaagaccgtgacaacgacgagagcccctctaactgtgccgcgcagttccagggggcc
tggtggtatcacagctgccactcgtccaacctgaacggccgctacctcaggggcccgcac
acgagctacgccaacggcatcaactggaagtcgtggggccggtacaactacagctacaaa
gtgtcggagatgaagctgcggctcacctag

DBGET integrated database retrieval system