KEGG   Bos taurus (cow): 497032Help
Entry
497032            CDS       T01008                                 

Gene name
MTHFR
Definition
(RefSeq) methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
bta  Bos taurus (cow)
Pathway
bta00670  One carbon pool by folate
bta01100  Metabolic pathways
bta01200  Carbon metabolism
bta01523  Antifolate resistance
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    497032 (MTHFR)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    497032 (MTHFR)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     497032 (MTHFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 497032
NCBI-ProteinID: NP_001011685
Ensembl: ENSBTAG00000020698
VGNC: 31731
UniProt: Q5I598
Position
16
AA seq 655 aa AA seqDB search
MVNEPRGNGSPGPRWEGSSSGSESSRTSSRCSTPGLDPERCERLREKMKRKMDSGDKWFS
LEFFPPRTAQGAVNLISRFDRMGAGGPLFVDVTWHPAGDPGSDKETSSMVIASTAVNYCG
LETILHMTCCHQSREEITGHLNKAKQLGLKNILALRGDPIGDQWEEEEGGFNYATDLVKH
IRNEFGDYFDVCVAGYPKGHPEGESFEADLKHLKEKVAAGADFIITQLFFEAETFFRFVK
ACSEIGITCPVLPGIFPIQGYHSLRQLVKLSKLEVPQQIKDVIEPIKDNDAAIRNYGIEQ
AVSLCQELLASGLVPGLHFYTLNREVATIEVLKRLGLWIEDPRRPLPWALSAHPKRRVED
VRPIFWASRPKSYIYRTQEWDEFPNGRWGNSSSPAFGELKDYYLFYLKSKSPKEELLKMW
GEELTSEESVFQVFAHHLSGEPNQNGYKVTCLPWNDEPLAAETSLMKEELLRVNRRGILT
INSQPNINGKPSSDPIVGWGPSGGYVFQKAYLEFFTSRETVEALLQVLKKYELRVNYHIV
DVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPVSFMFWKDEAFALWIEQWGKLYEE
ESPSRMIIQYIHDNYFLVNLVDNEFPLDNCLWQVVEDTFELLSRPPQDKRETEAL
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacgaacccagagggaacggcagccccggcccccgctgggagggcagcagcagc
ggcagcgagagctcaaggacaagttcaaggtgctccacgccggggttggaccccgagcga
tgcgagagactccgggagaagatgaagcggaagatggactctggagacaagtggttctcc
ctagagttcttccctccccgaactgcccagggtgctgtcaatctcatctccaggtttgac
cggatgggagcgggtggccccctctttgtagacgtgacctggcacccagccggggatcct
ggctccgacaaggagacctcgtccatggtgattgccagcactgccgtgaactactgcggc
ctcgagacaatcctgcacatgacctgctgccatcagagccgtgaagagatcacgggccac
ctgaacaaagccaagcagctgggcctgaagaacatcctggcgctgaggggagaccccata
ggtgaccaatgggaagaggaggaaggaggcttcaactatgctacggacttggtgaagcac
atccgaaacgagtttggtgactactttgacgtctgtgtggcaggttaccccaaaggccac
cctgaaggagagagctttgaggctgatctgaagcacctgaaggagaaggtggctgcagga
gccgacttcatcatcacccagctattctttgaggctgaaacattcttccgctttgtgaag
gcttgctccgagataggcattacctgccccgtcctccccggcatcttcccaattcagggc
taccactccctccggcagctggtgaaactgtccaaactggaggtgccacagcagatcaag
gatgtgatcgagcccatcaaagacaatgatgctgccatccgcaactatggcatcgagcag
gccgtgagcctgtgccaggagctgctggccagtggcttggttccaggcctccacttctac
accctcaaccgcgaggtggccaccatcgaggtgctgaagcgcctggggctttggattgag
gaccctaggcgtcccctgccctgggccctcagtgcccaccccaagcgccgggtggaggat
gtccggcccatcttctgggcctcgagaccaaagagttacatttaccgtacgcaggagtgg
gacgagttccccaatggccgctggggcaattcctcctctccggcctttggggagctgaag
gactactacctcttctacctaaagagcaagtccccgaaggaggagctgctcaagatgtgg
ggggaggagctgaccagtgaggaaagcgtcttccaagtctttgcccaccacctctcggga
gagcccaaccagaatggctacaaagtgacttgcctgccctggaatgatgagcccctggca
gccgagaccagcctgatgaaggaggagctgctgagagtgaaccggcgaggcatcctcacc
atcaactcccagcccaacatcaacgggaagccgtcctctgaccccatcgtgggctggggc
cccagtgggggctatgtcttccagaaggcctacttagagttcttcacttcccgagaaacg
gtggaggcgcttttgcaggtgctgaagaagtatgaactccgggtgaattaccacatcgtg
gatgtgaagggtgaaaatatcaccaacgcccctgagctgcaacccaacgcggtcacctgg
ggcatcttccctggccgagagatcatccagcccacagtggtggacccggtcagcttcatg
ttctggaaggatgaggccttcgcgctgtggattgagcagtggggcaagctgtatgaggag
gagtccccctcccgcatgatcatccagtacatccacgacaactacttcctggtcaacctg
gtggacaacgagtttccgctggacaactgcctgtggcaggtggtggaagacacgtttgag
cttctcagcaggcccccccaagacaagagggagacagaggcgctgtga

DBGET integrated database retrieval system