KEGG   Bos taurus (cow): 503684
Entry
503684            CDS       T01008                                 

Gene name
HMGCS2
Definition
(RefSeq) hydroxymethylglutaryl-CoA synthase, mitochondrial precursor
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
bta  Bos taurus (cow)
Pathway
bta00072  Synthesis and degradation of ketone bodies
bta00280  Valine, leucine and isoleucine degradation
bta00650  Butanoate metabolism
bta00900  Terpenoid backbone biosynthesis
bta01100  Metabolic pathways
bta03320  PPAR signaling pathway
Module
bta_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    503684 (HMGCS2)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    503684 (HMGCS2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    503684 (HMGCS2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    503684 (HMGCS2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    503684 (HMGCS2)
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     503684 (HMGCS2)
SSDB
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III
Other DBs
NCBI-GeneID: 503684
NCBI-ProteinID: NP_001039348
BGD-bta: BT17324
Ensembl: ENSBTAG00000003898
VGNC: 29881
UniProt: Q2KIE6
Position
3
AA seq 508 aa
MQRLLTPVRQVLQVKRVMQEASLLPARLLPAAHPSFSTVPAVPLAKTDTWPKDVGILAME
VYFPAQYVDQTELEKFNKVEAGRYTVGLGQTQMGFCSVQEDVNSLCLTVVQQLMERTQLP
WDSVGRLEVGTETIIDKSKAVKTVLMELFQDSGNTDIEGIDTTNACYGGTASLFNAANWM
ESSSWDGRYALVVCGDIAVYPSGNARPTGGAGAVAMLVGPEAPLVLERGLRGTHMENVYD
FYKPDVTSEYPLVDGKLSIQCYLRALDKCYAFYRQKIEKQWKQAGIDRPFTLDDVQYMIF
HTPFCKLVQKSLARLMFNDFLLASGDTQTGIYKGLEAFRGLKLEDTYTNKDVDKAFLKAS
LNMFNKKTKNSLYLSTYNGNMYTSSLYGCLASLLAHHSAQDLAGSRIGAFSYGSGLAASF
FSFRVSQDASPGSPLEKLVSSTSDLQKRLASRKRVSPEEFTEIMNQREQYYHKMNFSPPG
DKNSLFPGTWYLERVDELYRRKYARRPV
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgcagcggctgttgactccagtgaggcaggtgttgcaagtgaagagagtgatgcaagaa
gcttccctcctgcctgcccgccttctcccagcagcccaccccagtttttctacagttccg
gctgtccccttggccaaaacagatacttggccaaaggatgtgggtattcttgccatggag
gtctactttccagcccaatatgtggaccaaacagagctggagaagtttaacaaagtggag
gcagggaggtacaccgtgggcttgggccagacccagatgggcttctgctcagtccaggag
gatgtcaactccctgtgcctgacggtggtgcaacagctgatggagcgcacgcagctcccc
tgggactctgtgggccgcctggaagtgggcactgagaccatcatcgataagtccaaggct
gtcaaaacagtgcttatggagctcttccaggattcaggcaacactgacattgagggcata
gataccaccaatgcctgctacggtggcactgcctccctcttcaatgctgccaactggatg
gaatccagctcctgggatggtcgctatgcactggtggtctgtggggacatcgcagtctac
cccagtggtaacgctcgccccacaggcggggctggagctgtggcaatgctggttgggcct
gaggcccctctggtcctcgagagagggcttagaggaacccacatggagaatgtgtacgac
ttctacaaaccagatgtgacttcagagtacccactggtggatgggaagctctccatccag
tgctacttacgggccctggacaaatgctatgcattctaccgtcaaaagatcgagaaacag
tggaagcaagctggcatcgatcggcctttcactctcgatgatgtgcagtatatgattttt
cacacgcctttctgcaagttagtccagaaatccctggcccgcctgatgttcaatgacttc
ctgttggccagtggtgacacacagactggcatctacaagggcttggaggccttcagggga
ctaaagctggaagacacctacaccaataaggatgtagataaagcatttctaaaagcctct
ctgaacatgttcaataagaaaaccaagaactccctctacctctccacgtacaacgggaat
atgtacacctcatccctatatggatgcctggcctcacttctggcccatcactctgcccaa
gacttggctggctccaggatcggtgccttctcttatggctctggtttggcagcaagtttc
ttttctttccgggtgtcccaggatgcttctccaggctccccactggagaagctggtatcc
agtacatcagacctgcagaaacgtcttgcctcccggaagcgtgtgtctcctgaggagttc
acagaaataatgaaccaaagagaacaatactaccacaagatgaatttctcaccacctggt
gataagaacagccttttcccaggcacttggtacctggagcgagtggatgagctgtatcgc
aggaagtacgcccggcgtcccgtttaa

DBGET integrated database retrieval system