KEGG   Bos taurus (cow): 504229Help
Entry
504229            CDS       T01008                                 

Gene name
TMEM126B
Definition
(RefSeq) complex I assembly factor TMEM126B, mitochondrial
  KO
K18165  complex I assembly factor TMEM126B
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bta03029]
    504229 (TMEM126B)
Mitochondrial biogenesis [BR:bta03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-I assembly factors
    504229 (TMEM126B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TMEM126
Motif
Other DBs
NCBI-GeneID: 504229
NCBI-ProteinID: XP_002699085
BGD-bta: BT14229
Ensembl: ENSBTAG00000020596
VGNC: 35959
UniProt: E1BCS4
Position
29
AA seq 230 aa AA seqDB search
MAALGREAGDDVRVAGVVPVGAAEVPKDIKIPTYTHGQSRPSLGDAKLSKPVVIEIIEKK
IECLRKEKTLNIYGTLTFGTTAAFSGMLTNFIFRHRFKVTHDVLKTYASLTALPFLSTIV
SYKLLVTDALCSGNISQENCVLRSSLIGIACGVLYPTALAFSKNGRLAFKYHTVPMPPKG
RVLLYWLLLCHTEIKAMVIPLILQTTFGICHGLQHYAIFESTLEKTVHED
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctcgggcgtgaggctggagacgacgtgcgggttgccggtgtggtgccggtg
ggagctgcggaagtgcctaaggacatcaagataccaacatacacacatggtcagtccagg
ccttctctaggagatgcaaaactcagcaaaccagtagtcatcgaaatcatagaaaaaaaa
attgaatgccttagaaaagaaaagactttaaatatatatggaacactgacctttggaaca
acagctgctttctctggaatgttgacaaacttcattttcagacatcgcttcaaggtcacg
catgatgttttgaagacatatgcatcattgactgcacttccatttttgtctaccatagtt
tcttataagcttcttgtaacagatgctttgtgttcaggtaacataagccaggaaaattgt
gttcttagaagctcactgattggcatagcatgtggtgttttatatcccactgctttggct
ttttctaaaaatggacgtctggcattcaagtatcatactgttcccatgccaccaaaagga
agggttttactttattggctgctgctttgtcatacagagataaaagcaatggtgatccct
ctcatccttcagacaacctttggaatatgtcatggtctgcagcactatgcaatatttgaa
agtacacttgagaaaactgttcatgaagattaa

DBGET integrated database retrieval system